BLASTX nr result
ID: Rehmannia25_contig00020068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00020068 (381 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310209.2| hypothetical protein POPTR_0007s12550g [Popu... 58 2e-06 >ref|XP_002310209.2| hypothetical protein POPTR_0007s12550g [Populus trichocarpa] gi|550334732|gb|EEE90659.2| hypothetical protein POPTR_0007s12550g [Populus trichocarpa] Length = 565 Score = 57.8 bits (138), Expect = 2e-06 Identities = 41/76 (53%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Frame = +1 Query: 136 EIGTMRMTITEAETMTGGKIMAEIGRIDSDIGLDLAQGPSLSTDQGRGLVHDPEAKG*VG 315 EIG M M ITEAETMTG + M E + D+G DL Q LSTDQG L AKG V Sbjct: 112 EIG-MVMIITEAETMTGRETMIETKKTGIDVGRDLVQRVDLSTDQGHAL----RAKGSVV 166 Query: 316 LTW-HLLLNCFPMLLL 360 L W LLL C +LLL Sbjct: 167 LIWLLLLLQCCLVLLL 182