BLASTX nr result
ID: Rehmannia25_contig00019832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00019832 (467 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 62 6e-08 ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260... 59 5e-07 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] Length = 41 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 204 MSAILSELFFSGFMINSTYRRRTHLVQSFSVV 299 MSAILSELF SGFMINSTYRRRTHLVQSFSVV Sbjct: 1 MSAILSELFLSGFMINSTYRRRTHLVQSFSVV 32 >ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260774 [Solanum lycopersicum] Length = 41 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 204 MSAILSELFFSGFMINSTYRRRTHLVQSFSVV 299 MSAIL+ELF GFMINSTYRRRTHLVQSFSVV Sbjct: 1 MSAILNELFLCGFMINSTYRRRTHLVQSFSVV 32