BLASTX nr result
ID: Rehmannia25_contig00019770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00019770 (636 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG43556.1|AF211538_1 Avr9/Cf-9 rapidly elicited protein 180 ... 60 7e-07 >gb|AAG43556.1|AF211538_1 Avr9/Cf-9 rapidly elicited protein 180 [Nicotiana tabacum] Length = 102 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/44 (65%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = -2 Query: 476 WKLKS-SAGLRWKKR--FNLHLWFVDGFLFKIVSVFEAVVLVST 354 W+ K+ S+GLRW K+ + LH WFVD FLFKIVSVFEA+ LVST Sbjct: 47 WRFKNLSSGLRWNKKSLYKLHHWFVDSFLFKIVSVFEAIALVST 90