BLASTX nr result
ID: Rehmannia25_contig00019677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00019677 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY29025.1| SMAD/FHA domain-containing protein isoform 1 [The... 57 3e-06 >gb|EOY29025.1| SMAD/FHA domain-containing protein isoform 1 [Theobroma cacao] gi|508781770|gb|EOY29026.1| SMAD/FHA domain-containing protein isoform 1 [Theobroma cacao] gi|508781771|gb|EOY29027.1| SMAD/FHA domain-containing protein isoform 1 [Theobroma cacao] Length = 414 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +3 Query: 6 RGGIYDDLYGDSLSVKVGSSWAYTSVVSRGREAKNEGNNPRGELV 140 +GGIYDDLYG+SLS KVGSSWAY+SV GR+A ++ G+ + Sbjct: 345 KGGIYDDLYGESLSDKVGSSWAYSSVSCAGRQASPTQDDTTGKAI 389