BLASTX nr result
ID: Rehmannia25_contig00019603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00019603 (398 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004497450.1| PREDICTED: two-component response regulator-... 59 5e-07 ref|XP_004497449.1| PREDICTED: two-component response regulator-... 59 5e-07 ref|XP_006588746.1| PREDICTED: two-component response regulator-... 59 9e-07 ref|XP_006588745.1| PREDICTED: two-component response regulator-... 59 9e-07 ref|XP_003536977.1| PREDICTED: two-component response regulator-... 59 9e-07 gb|ESW16511.1| hypothetical protein PHAVU_007G162500g [Phaseolus... 58 1e-06 gb|ESW16510.1| hypothetical protein PHAVU_007G162500g [Phaseolus... 58 1e-06 ref|XP_006594103.1| PREDICTED: two-component response regulator-... 58 1e-06 ref|XP_006594104.1| PREDICTED: two-component response regulator-... 58 1e-06 ref|XP_002525199.1| sensory transduction histidine kinase, putat... 55 7e-06 >ref|XP_004497450.1| PREDICTED: two-component response regulator-like APRR7-like isoform X2 [Cicer arietinum] Length = 777 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = -2 Query: 262 NGSSTAINAVGTYAKSDFGQARNSGSGD---SGSGTRIDENKSSQREAAL 122 NGSS AINA GT +S+ G NSGSGD SGS R+D+NK+SQREAAL Sbjct: 675 NGSSNAINAAGTNIESNNGLTGNSGSGDASGSGSANRVDQNKNSQREAAL 724 >ref|XP_004497449.1| PREDICTED: two-component response regulator-like APRR7-like isoform X1 [Cicer arietinum] Length = 781 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = -2 Query: 262 NGSSTAINAVGTYAKSDFGQARNSGSGD---SGSGTRIDENKSSQREAAL 122 NGSS AINA GT +S+ G NSGSGD SGS R+D+NK+SQREAAL Sbjct: 679 NGSSNAINAAGTNIESNNGLTGNSGSGDASGSGSANRVDQNKNSQREAAL 728 >ref|XP_006588746.1| PREDICTED: two-component response regulator-like APRR7-like isoform X3 [Glycine max] Length = 749 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = -2 Query: 262 NGSSTAINAVGTYAKSDFGQARNSGSGD---SGSGTRIDENKSSQREAAL 122 NGSSTA+NA GT +S+ G NSGSGD SGS R+D+NK+SQRE AL Sbjct: 646 NGSSTAVNAGGTNTESNNGLTGNSGSGDASGSGSANRVDQNKTSQREVAL 695 >ref|XP_006588745.1| PREDICTED: two-component response regulator-like APRR7-like isoform X2 [Glycine max] Length = 753 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = -2 Query: 262 NGSSTAINAVGTYAKSDFGQARNSGSGD---SGSGTRIDENKSSQREAAL 122 NGSSTA+NA GT +S+ G NSGSGD SGS R+D+NK+SQRE AL Sbjct: 650 NGSSTAVNAGGTNTESNNGLTGNSGSGDASGSGSANRVDQNKTSQREVAL 699 >ref|XP_003536977.1| PREDICTED: two-component response regulator-like APRR7-like isoform X1 [Glycine max] Length = 747 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = -2 Query: 262 NGSSTAINAVGTYAKSDFGQARNSGSGD---SGSGTRIDENKSSQREAAL 122 NGSSTA+NA GT +S+ G NSGSGD SGS R+D+NK+SQRE AL Sbjct: 644 NGSSTAVNAGGTNTESNNGLTGNSGSGDASGSGSANRVDQNKTSQREVAL 693 >gb|ESW16511.1| hypothetical protein PHAVU_007G162500g [Phaseolus vulgaris] Length = 744 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -2 Query: 262 NGSSTAINAVGTYAKSDFGQARNSGSGD---SGSGTRIDENKSSQREAAL 122 NGSSTA+NA GT +S+ G NSGSGD SGS ++D+NK+SQREAAL Sbjct: 641 NGSSTAVNAGGTNMESNNGLPGNSGSGDASGSGSANKVDQNKTSQREAAL 690 >gb|ESW16510.1| hypothetical protein PHAVU_007G162500g [Phaseolus vulgaris] Length = 740 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -2 Query: 262 NGSSTAINAVGTYAKSDFGQARNSGSGD---SGSGTRIDENKSSQREAAL 122 NGSSTA+NA GT +S+ G NSGSGD SGS ++D+NK+SQREAAL Sbjct: 637 NGSSTAVNAGGTNMESNNGLPGNSGSGDASGSGSANKVDQNKTSQREAAL 686 >ref|XP_006594103.1| PREDICTED: two-component response regulator-like APRR7-like isoform X1 [Glycine max] Length = 755 Score = 57.8 bits (138), Expect = 1e-06 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = -2 Query: 262 NGSSTAINAVGTYAKSDFGQARNSGSGD---SGSGTRIDENKSSQREAAL 122 NGSSTA+NA GT KS+ G NSGSGD S S R+D+NK+SQREAAL Sbjct: 652 NGSSTAVNAGGTNMKSNNGLTGNSGSGDASGSVSANRVDQNKTSQREAAL 701 >ref|XP_006594104.1| PREDICTED: two-component response regulator-like APRR7-like isoform X2 [Glycine max] Length = 749 Score = 57.8 bits (138), Expect = 1e-06 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = -2 Query: 262 NGSSTAINAVGTYAKSDFGQARNSGSGD---SGSGTRIDENKSSQREAAL 122 NGSSTA+NA GT KS+ G NSGSGD S S R+D+NK+SQREAAL Sbjct: 646 NGSSTAVNAGGTNMKSNNGLTGNSGSGDASGSVSANRVDQNKTSQREAAL 695 >ref|XP_002525199.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223535496|gb|EEF37165.1| sensory transduction histidine kinase, putative [Ricinus communis] Length = 762 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/48 (64%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = -2 Query: 262 NGSSTAINAVGTYAKSDFGQARNSGSGD-SGSGTRIDENKSSQREAAL 122 NGSSTA+NA GT +SD G SGSGD SG G R D+NK SQRE AL Sbjct: 665 NGSSTAVNAGGTNVESDNGIGGKSGSGDGSGEGNRGDQNKFSQREVAL 712