BLASTX nr result
ID: Rehmannia25_contig00019330
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00019330 (392 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324570.1| predicted protein [Populus trichocarpa] 55 7e-06 >ref|XP_002324570.1| predicted protein [Populus trichocarpa] Length = 310 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/53 (52%), Positives = 33/53 (62%) Frame = +2 Query: 2 PYHRNCSCALHKSKDGSSNATPCFHRKNVLVMKKSVWYNYKCSLSIETPQFLL 160 PYHRNCSCALHK + GSS P +N+ KK W +CSLS+ TP LL Sbjct: 29 PYHRNCSCALHKMEGGSSTGFPL--PRNMFYPKKQSW--RRCSLSLATPSILL 77