BLASTX nr result
ID: Rehmannia25_contig00019321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00019321 (333 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20026.3| unnamed protein product [Vitis vinifera] 92 5e-17 ref|XP_002267905.1| PREDICTED: pentatricopeptide repeat-containi... 92 5e-17 ref|XP_002269315.1| PREDICTED: pentatricopeptide repeat-containi... 90 3e-16 emb|CBI21803.3| unnamed protein product [Vitis vinifera] 90 3e-16 ref|XP_004297230.1| PREDICTED: proteinaceous RNase P 1, chloropl... 90 4e-16 ref|XP_004241814.1| PREDICTED: proteinaceous RNase P 1, chloropl... 88 1e-15 ref|XP_006353636.1| PREDICTED: proteinaceous RNase P 1, chloropl... 87 2e-15 ref|XP_002526061.1| multidrug resistance pump, putative [Ricinus... 87 3e-15 ref|XP_002305261.1| pentatricopeptide repeat-containing family p... 86 4e-15 dbj|BAK07318.1| predicted protein [Hordeum vulgare subsp. vulgare] 84 2e-14 ref|XP_006484639.1| PREDICTED: proteinaceous RNase P 1, chloropl... 84 3e-14 ref|XP_006437491.1| hypothetical protein CICLE_v10031025mg [Citr... 84 3e-14 ref|XP_006437490.1| hypothetical protein CICLE_v10031025mg [Citr... 84 3e-14 gb|EMJ26904.1| hypothetical protein PRUPE_ppa003560mg [Prunus pe... 83 3e-14 gb|ACR37462.1| unknown [Zea mays] gi|414586240|tpg|DAA36811.1| T... 83 3e-14 ref|NP_001147555.1| antiporter/ drug transporter/ transporter [Z... 83 3e-14 gb|EXB44847.1| hypothetical protein L484_026428 [Morus notabilis] 83 4e-14 ref|XP_006856537.1| hypothetical protein AMTR_s00046p00150030 [A... 83 4e-14 ref|XP_002323962.2| hypothetical protein POPTR_0017s01370g [Popu... 82 6e-14 ref|XP_002327484.1| predicted protein [Populus trichocarpa] 82 6e-14 >emb|CBI20026.3| unnamed protein product [Vitis vinifera] Length = 393 Score = 92.4 bits (228), Expect = 5e-17 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = +2 Query: 11 GLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTRPHE*APSQV 172 G LHMPPPYS+VIQESE+GSWH+PTVTGDDLETP+QW+CATRTR + P + Sbjct: 285 GPVLHMPPPYSIVIQESEQGSWHVPTVTGDDLETPRQWLCATRTRKNHRHPQHL 338 >ref|XP_002267905.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Vitis vinifera] Length = 526 Score = 92.4 bits (228), Expect = 5e-17 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = +2 Query: 11 GLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTRPHE*APSQV 172 G LHMPPPYS+VIQESE+GSWH+PTVTGDDLETP+QW+CATRTR + P + Sbjct: 472 GPVLHMPPPYSIVIQESEQGSWHVPTVTGDDLETPRQWLCATRTRKNHRHPQHL 525 >ref|XP_002269315.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Vitis vinifera] Length = 895 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = +2 Query: 11 GLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTRPHE*APSQV 172 G LHMPPPYS+VIQESE+GSWH+PTV GDDLETP+QW+CATRTR + P + Sbjct: 841 GPVLHMPPPYSIVIQESEQGSWHVPTVIGDDLETPRQWLCATRTRKNHRHPQHL 894 >emb|CBI21803.3| unnamed protein product [Vitis vinifera] Length = 339 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = +2 Query: 11 GLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTRPHE*APSQV 172 G LHMPPPYS+VIQESE+GSWH+PTV GDDLETP+QW+CATRTR + P + Sbjct: 285 GPVLHMPPPYSIVIQESEQGSWHVPTVIGDDLETPRQWLCATRTRKNHRHPQHL 338 >ref|XP_004297230.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like [Fragaria vesca subsp. vesca] Length = 564 Score = 89.7 bits (221), Expect = 4e-16 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = +2 Query: 2 SDYGLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTR 145 S GL LHMPPPYS+VIQESE GSWH+PT TGDD+ETP+QW+CATR R Sbjct: 514 SKLGLNLHMPPPYSIVIQESEDGSWHVPTTTGDDIETPRQWLCATRAR 561 >ref|XP_004241814.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like [Solanum lycopersicum] Length = 567 Score = 87.8 bits (216), Expect = 1e-15 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +2 Query: 5 DYGLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTR 145 D GL LHMPPPYS+VIQESE+G WHIPT+TGDDLE P+QWVCATR + Sbjct: 514 DDGLKLHMPPPYSIVIQESEQGCWHIPTLTGDDLEIPRQWVCATRKK 560 >ref|XP_006353636.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like isoform X1 [Solanum tuberosum] gi|565374171|ref|XP_006353637.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like isoform X2 [Solanum tuberosum] Length = 574 Score = 87.4 bits (215), Expect = 2e-15 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = +2 Query: 5 DYGLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTR 145 D GL LHMPPPYS+VIQESE+G WH+PT+TGDDLE P+QWVCATR + Sbjct: 514 DDGLKLHMPPPYSIVIQESEQGCWHVPTLTGDDLEIPRQWVCATRKK 560 >ref|XP_002526061.1| multidrug resistance pump, putative [Ricinus communis] gi|223534642|gb|EEF36338.1| multidrug resistance pump, putative [Ricinus communis] Length = 589 Score = 86.7 bits (213), Expect = 3e-15 Identities = 34/45 (75%), Positives = 42/45 (93%) Frame = +2 Query: 11 GLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTR 145 G+ LHMPPPYS+VIQESE GSWH+PT++ DDLETP+QW+CA+RTR Sbjct: 540 GIALHMPPPYSIVIQESENGSWHVPTISEDDLETPRQWLCASRTR 584 >ref|XP_002305261.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222848225|gb|EEE85772.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 516 Score = 86.3 bits (212), Expect = 4e-15 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +2 Query: 11 GLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATR 139 G+ LHMPPPYS+VIQESE G WH+PT TGDDLETP+QW+CATR Sbjct: 470 GIALHMPPPYSIVIQESENGGWHVPTTTGDDLETPRQWLCATR 512 >dbj|BAK07318.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 692 Score = 84.0 bits (206), Expect = 2e-14 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +2 Query: 2 SDYGLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATR 139 S G T H+PPPYS+VIQESE GSWH+PT TGDD+E+P+QWVCATR Sbjct: 509 SGRGPTFHLPPPYSIVIQESEAGSWHVPTTTGDDIESPRQWVCATR 554 >ref|XP_006484639.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like [Citrus sinensis] Length = 593 Score = 83.6 bits (205), Expect = 3e-14 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +2 Query: 11 GLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTR 145 GL L MPPPYS+VIQESE GSWH+P +TGDDLE P+QW+CATR R Sbjct: 539 GLNLLMPPPYSIVIQESENGSWHVPVITGDDLEAPRQWLCATRAR 583 >ref|XP_006437491.1| hypothetical protein CICLE_v10031025mg [Citrus clementina] gi|557539687|gb|ESR50731.1| hypothetical protein CICLE_v10031025mg [Citrus clementina] Length = 593 Score = 83.6 bits (205), Expect = 3e-14 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +2 Query: 11 GLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTR 145 GL L MPPPYS+VIQESE GSWH+P +TGDDLE P+QW+CATR R Sbjct: 539 GLNLLMPPPYSIVIQESENGSWHVPVITGDDLEAPRQWLCATRAR 583 >ref|XP_006437490.1| hypothetical protein CICLE_v10031025mg [Citrus clementina] gi|557539686|gb|ESR50730.1| hypothetical protein CICLE_v10031025mg [Citrus clementina] Length = 584 Score = 83.6 bits (205), Expect = 3e-14 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +2 Query: 11 GLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTR 145 GL L MPPPYS+VIQESE GSWH+P +TGDDLE P+QW+CATR R Sbjct: 530 GLNLLMPPPYSIVIQESENGSWHVPVITGDDLEAPRQWLCATRAR 574 >gb|EMJ26904.1| hypothetical protein PRUPE_ppa003560mg [Prunus persica] Length = 565 Score = 83.2 bits (204), Expect = 3e-14 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +2 Query: 2 SDYGLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATR 139 S GL LHMPPPYS+VIQESE G WH+PT GDD+ETP+QW+CATR Sbjct: 514 SRQGLALHMPPPYSIVIQESEDGRWHVPTTIGDDIETPRQWLCATR 559 >gb|ACR37462.1| unknown [Zea mays] gi|414586240|tpg|DAA36811.1| TPA: hypothetical protein ZEAMMB73_657460 [Zea mays] Length = 77 Score = 83.2 bits (204), Expect = 3e-14 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +2 Query: 2 SDYGLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATR 139 S +G TLH+PPPYS+VIQESE GSWH+PT TGDD+E P+QW+C TR Sbjct: 28 SGHGPTLHLPPPYSIVIQESEDGSWHVPTTTGDDIEKPRQWLCTTR 73 >ref|NP_001147555.1| antiporter/ drug transporter/ transporter [Zea mays] gi|195612160|gb|ACG27910.1| antiporter/ drug transporter/ transporter [Zea mays] gi|219884449|gb|ACL52599.1| unknown [Zea mays] Length = 553 Score = 83.2 bits (204), Expect = 3e-14 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +2 Query: 2 SDYGLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATR 139 S +G TLH+PPPYS+VIQESE GSWH+PT TGDD+E P+QW+C TR Sbjct: 504 SGHGPTLHLPPPYSIVIQESEDGSWHVPTTTGDDIEKPRQWLCTTR 549 >gb|EXB44847.1| hypothetical protein L484_026428 [Morus notabilis] Length = 576 Score = 82.8 bits (203), Expect = 4e-14 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +2 Query: 2 SDYGLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATRTR 145 S G +LHMPPPYS+VIQESE G WH+P VTGDDLE P+QW+CATR R Sbjct: 526 STKGPSLHMPPPYSIVIQESEDGRWHVPMVTGDDLEAPRQWLCATRDR 573 >ref|XP_006856537.1| hypothetical protein AMTR_s00046p00150030 [Amborella trichopoda] gi|548860418|gb|ERN18004.1| hypothetical protein AMTR_s00046p00150030 [Amborella trichopoda] Length = 513 Score = 82.8 bits (203), Expect = 4e-14 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +2 Query: 2 SDYGLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATR 139 S G HMPPPYS+VIQESERGSWH+PT+ GDD+ETP++W+CATR Sbjct: 449 SKNGPVFHMPPPYSIVIQESERGSWHVPTLVGDDIETPRKWLCATR 494 >ref|XP_002323962.2| hypothetical protein POPTR_0017s01370g [Populus trichocarpa] gi|550319033|gb|EEF04095.2| hypothetical protein POPTR_0017s01370g [Populus trichocarpa] Length = 578 Score = 82.4 bits (202), Expect = 6e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +2 Query: 11 GLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATR 139 G+ L MPPPYS+VIQESE GSWH+PT T DDLETP+QW+CATR Sbjct: 532 GIALQMPPPYSIVIQESENGSWHVPTTTNDDLETPRQWLCATR 574 >ref|XP_002327484.1| predicted protein [Populus trichocarpa] Length = 486 Score = 82.4 bits (202), Expect = 6e-14 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +2 Query: 11 GLTLHMPPPYSLVIQESERGSWHIPTVTGDDLETPKQWVCATR 139 G+ L MPPPYS+VIQESE GSWH+PT T DDLETP+QW+CATR Sbjct: 440 GIALQMPPPYSIVIQESENGSWHVPTTTNDDLETPRQWLCATR 482