BLASTX nr result
ID: Rehmannia25_contig00018908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00018908 (464 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67247.1| hypothetical protein M569_07524, partial [Genlise... 57 2e-06 ref|XP_002267912.1| PREDICTED: uncharacterized protein LOC100240... 55 1e-05 >gb|EPS67247.1| hypothetical protein M569_07524, partial [Genlisea aurea] Length = 774 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +3 Query: 336 SRLISWRPRPLAFRPYSPILDTNAKPQLLRVVVRKPLVARLTK 464 SRL+SWRP+PLAF P+ +D PQ LRV+VR+PLVARLTK Sbjct: 14 SRLVSWRPKPLAFHPFRQSMD----PQPLRVLVRRPLVARLTK 52 >ref|XP_002267912.1| PREDICTED: uncharacterized protein LOC100240775 [Vitis vinifera] Length = 957 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = +3 Query: 351 WRPRPLAFRPYSPILDTNAKPQLLRVVVRKPLVARLTK 464 WRP L F PYSP L+ K Q LRVVVR+PLVARLTK Sbjct: 34 WRPSKLVFAPYSPSLEAATKSQALRVVVRRPLVARLTK 71