BLASTX nr result
ID: Rehmannia25_contig00018742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00018742 (439 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD32582.1| Integrase, catalytic region; Zinc finger, CCHC-ty... 57 3e-06 gb|ABE88110.1| Reverse transcriptase (RNA-dependent DNA polymera... 57 3e-06 emb|CCI61386.1| putative reverse transcriptase (RNA-dependent DN... 55 1e-05 >gb|ABD32582.1| Integrase, catalytic region; Zinc finger, CCHC-type; Peptidase aspartic, catalytic [Medicago truncatula] Length = 1715 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = -3 Query: 437 NEVLYKIFSKLLQGKFKMIMMGELNFFIEIQVQQCQKGGYIPYSKYTKE 291 N L K FSKL+Q +F+M MMGEL FF+ IQ+ Q ++G Y+ +KYTKE Sbjct: 1411 NASLCKEFSKLMQDEFEMSMMGELKFFLGIQINQSKEGVYVHQTKYTKE 1459 >gb|ABE88110.1| Reverse transcriptase (RNA-dependent DNA polymerase), putative [Medicago truncatula] Length = 1654 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = -3 Query: 437 NEVLYKIFSKLLQGKFKMIMMGELNFFIEIQVQQCQKGGYIPYSKYTKE 291 N L K FSKL+Q +F+M MMGEL FF+ IQ+ Q ++G Y+ +KYTKE Sbjct: 1350 NASLCKEFSKLMQDEFEMSMMGELKFFLVIQINQSKEGVYVHQTKYTKE 1398 >emb|CCI61386.1| putative reverse transcriptase (RNA-dependent DNA polymerase), partial [Lens orientalis] Length = 225 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/49 (51%), Positives = 34/49 (69%) Frame = -3 Query: 437 NEVLYKIFSKLLQGKFKMIMMGELNFFIEIQVQQCQKGGYIPYSKYTKE 291 N +L K FSK +Q +FKM MMGEL +F+ IQ+ Q +G Y+ +KY KE Sbjct: 153 NAMLGKEFSKSMQAEFKMSMMGELKYFLRIQINQTSEGTYVHQTKYVKE 201