BLASTX nr result
ID: Rehmannia25_contig00018545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00018545 (399 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6... 67 2e-09 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 67 2e-09 ref|XP_004230848.1| PREDICTED: mitochondrial import receptor sub... 66 4e-09 ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citr... 66 5e-09 ref|XP_004492183.1| PREDICTED: mitochondrial import receptor sub... 65 7e-09 ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 f... 65 1e-08 gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] 63 4e-08 ref|XP_006590915.1| PREDICTED: mitochondrial import receptor sub... 62 1e-07 ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Popu... 61 2e-07 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 59 5e-07 gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus... 59 7e-07 gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlise... 59 9e-07 ref|XP_006592291.1| PREDICTED: mitochondrial import receptor sub... 57 3e-06 >gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 110 QLK HVAMFGVWVAVVRVTPY+LHY SD EELKLE Sbjct: 18 QLKVHVAMFGVWVAVVRVTPYILHYLSDDKEELKLE 53 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 110 QL+SHVAMFGVWVAV+RVTPY+LHY SD+ EELKL+ Sbjct: 18 QLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLD 53 >ref|XP_004230848.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] gi|565399930|ref|XP_006365492.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 110 QLK+HV +FG WVAV+RV PY+LHYFSDQ EELKLE Sbjct: 18 QLKTHVVLFGTWVAVIRVAPYILHYFSDQKEELKLE 53 >ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|567861008|ref|XP_006423158.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|568851345|ref|XP_006479354.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X1 [Citrus sinensis] gi|568851347|ref|XP_006479355.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Citrus sinensis] gi|557525091|gb|ESR36397.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|557525092|gb|ESR36398.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] Length = 54 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 110 QL+SHVAMFG WV V+RVTPYLLHYFS + EELKLE Sbjct: 18 QLRSHVAMFGTWVVVIRVTPYLLHYFSREKEELKLE 53 >ref|XP_004492183.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cicer arietinum] Length = 54 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI 113 QLKSHVAMFG WV V+RV PY+L+YF+D+ EELKLEI Sbjct: 18 QLKSHVAMFGTWVVVIRVAPYILYYFNDEKEELKLEI 54 >ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] Length = 54 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 110 QLKSHVAMFG WV V+RVTPY+LHY SD+ +ELKLE Sbjct: 18 QLKSHVAMFGAWVVVLRVTPYVLHYLSDEKDELKLE 53 >gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] Length = 54 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI 113 QL++HVAMFG WVAV+RVTPY+LHY S +++ELKLE+ Sbjct: 18 QLRTHVAMFGAWVAVIRVTPYILHYISRESDELKLEL 54 >ref|XP_006590915.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 54 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI 113 QLKSH AMFG WV V+RVTPY+LH+ S + EELKLE+ Sbjct: 18 QLKSHAAMFGAWVVVIRVTPYVLHFLSTEKEELKLEL 54 >ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] Length = 54 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 110 QL+SHVAMFG WV V+RVTPY+LHY S + +ELKLE Sbjct: 18 QLRSHVAMFGAWVVVLRVTPYVLHYISHEKDELKLE 53 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 110 QLK+H A+FG WVA++RVTPY+LHY SD +ELKL+ Sbjct: 18 QLKTHAAIFGAWVALIRVTPYVLHYLSDDKDELKLD 53 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI 113 QLKSH AMFG WV V+RVTPY+LH+ + EELKLE+ Sbjct: 18 QLKSHAAMFGTWVVVIRVTPYVLHFLCAEKEELKLEL 54 >gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] Length = 54 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI 113 QLKSHV MFG WV V+RVTPY+LH+ + + EELKL++ Sbjct: 18 QLKSHVTMFGAWVVVIRVTPYVLHFLTAEKEELKLQL 54 >gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlisea aurea] Length = 54 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 110 QLKSH MFG W+AVVR PY+LHY S + EELKLE Sbjct: 19 QLKSHAIMFGAWIAVVRAAPYVLHYLSGEKEELKLE 54 >ref|XP_006592291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 83 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +3 Query: 3 QLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI 113 QLKSHV MF WV V++VTPY+LH+ S + EELKLE+ Sbjct: 18 QLKSHVVMFQAWVVVIQVTPYVLHFLSTEKEELKLEL 54