BLASTX nr result
ID: Rehmannia25_contig00018322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00018322 (462 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN34118.1| hypothetical protein [Cucumis melo subsp. melo] 44 8e-06 >gb|ADN34118.1| hypothetical protein [Cucumis melo subsp. melo] Length = 701 Score = 43.9 bits (102), Expect(2) = 8e-06 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = +3 Query: 9 SLDEGIHYWRLCTLSKTFSKACLPCMPPNAKKFSSEDYKTWWNKVHGCYFQEN----IAS 176 +LD +++WR+CT T + LP K ++ + WW H YF++N ++S Sbjct: 256 TLDNILYHWRICTRRYTLFELYLPVRSLEPCKHVTQRFTDWWTTKHMTYFEDNRHHLVSS 315 Query: 177 LINMEQSDELPRGIGPTM 230 I+ LP+ G + Sbjct: 316 AISPPSQPRLPKNRGSNL 333 Score = 31.2 bits (69), Expect(2) = 8e-06 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +2 Query: 329 HPAEESSSNADRHWKRPKK 385 H E SS +DRHWKRP K Sbjct: 355 HKDESDSSKSDRHWKRPLK 373