BLASTX nr result
ID: Rehmannia25_contig00018145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00018145 (395 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307195.2| hypothetical protein POPTR_0005s10100g [Popu... 60 2e-07 ref|XP_006477997.1| PREDICTED: NAC domain-containing protein 21/... 58 1e-06 ref|XP_006441025.1| hypothetical protein CICLE_v10021117mg [Citr... 58 1e-06 ref|XP_006441024.1| hypothetical protein CICLE_v10021117mg [Citr... 58 1e-06 ref|XP_002529954.1| NAC domain-containing protein 21/22, putativ... 57 2e-06 gb|AFV70627.1| NAC1 [Populus tremula x Populus alba] 56 6e-06 >ref|XP_002307195.2| hypothetical protein POPTR_0005s10100g [Populus trichocarpa] gi|550338521|gb|EEE94191.2| hypothetical protein POPTR_0005s10100g [Populus trichocarpa] Length = 251 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = +1 Query: 25 VIKAVLNHHHLTKMESFGNDDDNKPGMIKGSPSFGEASPDSYLSEVGLSSMWNIHY 192 V+K VLN+ LTKMES+GN +KGSPS GE S +SY+SEVG+SS+WN HY Sbjct: 207 VLKTVLNN--LTKMESYGN--------LKGSPSLGEGSSESYISEVGMSSLWN-HY 251 >ref|XP_006477997.1| PREDICTED: NAC domain-containing protein 21/22-like [Citrus sinensis] Length = 324 Score = 57.8 bits (138), Expect = 1e-06 Identities = 35/57 (61%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +1 Query: 25 VIKAVLNHHHLTKMESFGNDDDNKPGMIKGSPSFGEASPDSYLSEVGL-SSMWNIHY 192 VIKAVLN LTK+ES N P M SPS GE SPDSYLSEVG+ ++MWN HY Sbjct: 276 VIKAVLNQ--LTKIES------NVPNMQGSSPSLGEPSPDSYLSEVGMPTNMWNHHY 324 >ref|XP_006441025.1| hypothetical protein CICLE_v10021117mg [Citrus clementina] gi|557543287|gb|ESR54265.1| hypothetical protein CICLE_v10021117mg [Citrus clementina] Length = 324 Score = 57.8 bits (138), Expect = 1e-06 Identities = 35/57 (61%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +1 Query: 25 VIKAVLNHHHLTKMESFGNDDDNKPGMIKGSPSFGEASPDSYLSEVGL-SSMWNIHY 192 VIKAVLN LTK+ES N P M SPS GE SPDSYLSEVG+ ++MWN HY Sbjct: 276 VIKAVLNQ--LTKIES------NVPNMQGSSPSLGEPSPDSYLSEVGMPTNMWNHHY 324 >ref|XP_006441024.1| hypothetical protein CICLE_v10021117mg [Citrus clementina] gi|557543286|gb|ESR54264.1| hypothetical protein CICLE_v10021117mg [Citrus clementina] Length = 327 Score = 57.8 bits (138), Expect = 1e-06 Identities = 35/57 (61%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +1 Query: 25 VIKAVLNHHHLTKMESFGNDDDNKPGMIKGSPSFGEASPDSYLSEVGL-SSMWNIHY 192 VIKAVLN LTK+ES N P M SPS GE SPDSYLSEVG+ ++MWN HY Sbjct: 279 VIKAVLNQ--LTKIES------NVPNMQGSSPSLGEPSPDSYLSEVGMPTNMWNHHY 327 >ref|XP_002529954.1| NAC domain-containing protein 21/22, putative [Ricinus communis] gi|223530552|gb|EEF32431.1| NAC domain-containing protein 21/22, putative [Ricinus communis] Length = 316 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = +1 Query: 25 VIKAVLNHHHLTKMESFGNDDDNKPGMIKGSPSFGEASPDSYLSEVGLSSMWNIHY 192 V KAVLN LTKME N PG + GSPS GE S +SYLSEVG+S++WN HY Sbjct: 271 VFKAVLNQ--LTKME-------NNPGSMHGSPSLGEGSSESYLSEVGMSNIWN-HY 316 >gb|AFV70627.1| NAC1 [Populus tremula x Populus alba] Length = 302 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = +1 Query: 25 VIKAVLNHHHLTKMESFGNDDDNKPGMIKGSPSFGEASPDSYLSEVGLSSMWNIHY 192 V+KAVLNH ++ MES N IKGSPS GE S +SYLS+VG+SS+WN HY Sbjct: 258 VLKAVLNHFNM--MESNAN--------IKGSPSLGEGSSESYLSDVGMSSLWN-HY 302