BLASTX nr result
ID: Rehmannia25_contig00018133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00018133 (338 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Popu... 80 4e-13 ref|XP_006379933.1| hypothetical protein POPTR_0008s17740g [Popu... 80 4e-13 ref|XP_002311721.2| hypothetical protein POPTR_0008s17740g [Popu... 80 4e-13 ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 80 4e-13 ref|XP_004310203.1| PREDICTED: OTU domain-containing protein At3... 76 4e-12 ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3... 75 7e-12 emb|CBI29898.3| unnamed protein product [Vitis vinifera] 75 7e-12 emb|CAN60311.1| hypothetical protein VITISV_002512 [Vitis vinifera] 75 7e-12 gb|EOY00869.1| Cysteine proteinases superfamily protein isoform ... 75 9e-12 gb|EOY00868.1| Cysteine proteinases superfamily protein isoform ... 75 9e-12 gb|EXC30911.1| OTU domain-containing protein [Morus notabilis] 75 1e-11 ref|XP_006591461.1| PREDICTED: OTU domain-containing protein At3... 75 1e-11 gb|ESW35734.1| hypothetical protein PHAVU_001G260200g [Phaseolus... 75 1e-11 ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3... 74 2e-11 gb|EXB94991.1| hypothetical protein L484_006757 [Morus notabilis] 74 2e-11 gb|EPS69774.1| hypothetical protein M569_04992, partial [Genlise... 74 3e-11 ref|XP_006850126.1| hypothetical protein AMTR_s00022p00229870 [A... 73 3e-11 tpg|DAA47955.1| TPA: hypothetical protein ZEAMMB73_390319 [Zea m... 73 4e-11 tpg|DAA47952.1| TPA: OTU-like cysteine protease family protein i... 73 4e-11 gb|ACN25982.1| unknown [Zea mays] 73 4e-11 >ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333321|gb|ERP57731.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 155 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELR 330 GIPGDGRCLFRSVVHGACLR GKPSPSES EKELADELR Sbjct: 9 GIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELADELR 47 >ref|XP_006379933.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333320|gb|ERP57730.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 163 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELR 330 GIPGDGRCLFRSVVHGACLR GKPSPSES EKELADELR Sbjct: 17 GIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELADELR 55 >ref|XP_002311721.2| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333319|gb|EEE89088.2| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 163 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELR 330 GIPGDGRCLFRSVVHGACLR GKPSPSES EKELADELR Sbjct: 17 GIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELADELR 55 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRCLFRSVVHGACLR GKPSP+ES EKELADELRA Sbjct: 25 GIPGDGRCLFRSVVHGACLREGKPSPTESLEKELADELRA 64 >ref|XP_004310203.1| PREDICTED: OTU domain-containing protein At3g57810-like [Fragaria vesca subsp. vesca] Length = 164 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GI GDGRCLFRSVVHGACLRAGKPSPS+S +KELAD+LRA Sbjct: 9 GIRGDGRCLFRSVVHGACLRAGKPSPSDSYQKELADDLRA 48 >ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3g57810-like [Vitis vinifera] Length = 340 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRCLFRSVVHGACLR+GKP+PS S ++ELADELRA Sbjct: 197 GIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELADELRA 236 >emb|CBI29898.3| unnamed protein product [Vitis vinifera] Length = 189 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRCLFRSVVHGACLR+GKP+PS S ++ELADELRA Sbjct: 46 GIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELADELRA 85 >emb|CAN60311.1| hypothetical protein VITISV_002512 [Vitis vinifera] Length = 806 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRCLFRSVVHGACLR+GKP+PS S ++ELADELRA Sbjct: 663 GIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELADELRA 702 >gb|EOY00869.1| Cysteine proteinases superfamily protein isoform 2, partial [Theobroma cacao] Length = 165 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRCLFRSVVHGA LRAGK SPSES +KELADELRA Sbjct: 19 GIPGDGRCLFRSVVHGAWLRAGKQSPSESHQKELADELRA 58 >gb|EOY00868.1| Cysteine proteinases superfamily protein isoform 1 [Theobroma cacao] Length = 175 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRCLFRSVVHGA LRAGK SPSES +KELADELRA Sbjct: 29 GIPGDGRCLFRSVVHGAWLRAGKQSPSESHQKELADELRA 68 >gb|EXC30911.1| OTU domain-containing protein [Morus notabilis] Length = 893 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRCLFRSV HGACLR+GKP+PSES ++ELAD LRA Sbjct: 750 GIPGDGRCLFRSVAHGACLRSGKPAPSESLQRELADNLRA 789 >ref|XP_006591461.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X2 [Glycine max] Length = 146 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRCLFRSVV+GACLR+G+PSPS S++KELADELRA Sbjct: 9 GIPGDGRCLFRSVVYGACLRSGEPSPSLSRQKELADELRA 48 >gb|ESW35734.1| hypothetical protein PHAVU_001G260200g [Phaseolus vulgaris] Length = 150 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRCLFRSVV+GACLR+G+PSPS S++KELADELRA Sbjct: 9 GIPGDGRCLFRSVVYGACLRSGEPSPSLSRQKELADELRA 48 >ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] gi|449522883|ref|XP_004168455.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] Length = 286 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRCLFRSV HGACLR+GKP+PSES +++LADELR+ Sbjct: 142 GIPGDGRCLFRSVAHGACLRSGKPAPSESLQRDLADELRS 181 >gb|EXB94991.1| hypothetical protein L484_006757 [Morus notabilis] Length = 158 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 217 IPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELR 330 IPGDGRCLFRSVVHGACLR GKP PSES+++ELADELR Sbjct: 17 IPGDGRCLFRSVVHGACLREGKPPPSESRQRELADELR 54 >gb|EPS69774.1| hypothetical protein M569_04992, partial [Genlisea aurea] Length = 196 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRCLFRS+ HGAC+R+GKP+PSES++ ELADELR+ Sbjct: 65 GIPGDGRCLFRSLAHGACIRSGKPAPSESRQMELADELRS 104 >ref|XP_006850126.1| hypothetical protein AMTR_s00022p00229870 [Amborella trichopoda] gi|548853724|gb|ERN11707.1| hypothetical protein AMTR_s00022p00229870 [Amborella trichopoda] Length = 244 Score = 73.2 bits (178), Expect = 3e-11 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRA 333 GIPGDGRC+FRSV HGACLR+GKP P+ES ++E+ADELRA Sbjct: 108 GIPGDGRCMFRSVAHGACLRSGKPPPNESVQREMADELRA 147 >tpg|DAA47955.1| TPA: hypothetical protein ZEAMMB73_390319 [Zea mays] Length = 150 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRAT 336 GIPGDGRCLFRSVVHGAC+R+G+P P+E +++LADELRAT Sbjct: 80 GIPGDGRCLFRSVVHGACIRSGRPIPNEDLQRKLADELRAT 120 >tpg|DAA47952.1| TPA: OTU-like cysteine protease family protein isoform 1 [Zea mays] gi|414869396|tpg|DAA47953.1| TPA: OTU-like cysteine protease family protein isoform 2 [Zea mays] gi|414869397|tpg|DAA47954.1| TPA: OTU-like cysteine protease family protein isoform 3 [Zea mays] Length = 223 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRAT 336 GIPGDGRCLFRSVVHGAC+R+G+P P+E +++LADELRAT Sbjct: 80 GIPGDGRCLFRSVVHGACIRSGRPIPNEDLQRKLADELRAT 120 >gb|ACN25982.1| unknown [Zea mays] Length = 236 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +1 Query: 214 GIPGDGRCLFRSVVHGACLRAGKPSPSESQEKELADELRAT 336 GIPGDGRCLFRSVVHGAC+R+G+P P+E +++LADELRAT Sbjct: 166 GIPGDGRCLFRSVVHGACIRSGRPIPNEDLQRKLADELRAT 206