BLASTX nr result
ID: Rehmannia25_contig00018040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00018040 (419 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311725.1| hypothetical protein POPTR_0008s17820g [Popu... 67 2e-09 gb|EOY00845.1| Uncharacterized protein isoform 1 [Theobroma cacao] 66 4e-09 ref|XP_006484055.1| PREDICTED: uncharacterized protein LOC102620... 66 5e-09 ref|XP_006438096.1| hypothetical protein CICLE_v10031526mg [Citr... 66 5e-09 gb|EMJ27893.1| hypothetical protein PRUPE_ppa020602mg [Prunus pe... 66 5e-09 ref|XP_006391254.1| hypothetical protein EUTSA_v10018471mg [Eutr... 65 9e-09 ref|XP_006301293.1| hypothetical protein CARUB_v10021714mg [Caps... 65 9e-09 gb|AAG52311.1|AC011020_18 hypothetical protein [Arabidopsis thal... 65 9e-09 ref|NP_564899.1| uncharacterized protein [Arabidopsis thaliana] ... 65 9e-09 ref|XP_002887131.1| predicted protein [Arabidopsis lyrata subsp.... 65 9e-09 ref|XP_002266342.1| PREDICTED: uncharacterized protein LOC100240... 65 9e-09 gb|AAM61061.1| unknown [Arabidopsis thaliana] 65 9e-09 ref|XP_004310198.1| PREDICTED: uncharacterized protein LOC101297... 64 2e-08 ref|XP_004237697.1| PREDICTED: uncharacterized protein LOC101248... 64 3e-08 ref|XP_003637303.1| hypothetical protein MTR_081s0004 [Medicago ... 62 6e-08 gb|ESW30700.1| hypothetical protein PHAVU_002G175600g [Phaseolus... 62 1e-07 ref|XP_004504467.1| PREDICTED: uncharacterized protein LOC101499... 62 1e-07 ref|XP_003531185.1| PREDICTED: uncharacterized protein LOC100813... 62 1e-07 ref|XP_003524884.1| PREDICTED: uncharacterized protein LOC100793... 62 1e-07 ref|XP_004142939.1| PREDICTED: uncharacterized protein LOC101221... 60 3e-07 >ref|XP_002311725.1| hypothetical protein POPTR_0008s17820g [Populus trichocarpa] gi|222851545|gb|EEE89092.1| hypothetical protein POPTR_0008s17820g [Populus trichocarpa] Length = 460 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDRGLINTIFFIELSL+TFVLGKT+V Sbjct: 425 ITIFGWTVDRGLINTIFFIELSLITFVLGKTIV 457 >gb|EOY00845.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 451 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDRGLINTIFFIEL+L+TFVLGKT+V Sbjct: 415 ITIFGWTVDRGLINTIFFIELTLITFVLGKTIV 447 >ref|XP_006484055.1| PREDICTED: uncharacterized protein LOC102620652 [Citrus sinensis] Length = 449 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVVS 102 ITIFGWTVDR LINTIFFIELSLVTFVLGKT+V+ Sbjct: 414 ITIFGWTVDRALINTIFFIELSLVTFVLGKTIVN 447 >ref|XP_006438096.1| hypothetical protein CICLE_v10031526mg [Citrus clementina] gi|557540292|gb|ESR51336.1| hypothetical protein CICLE_v10031526mg [Citrus clementina] Length = 449 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVVS 102 ITIFGWTVDR LINTIFFIELSLVTFVLGKT+V+ Sbjct: 414 ITIFGWTVDRALINTIFFIELSLVTFVLGKTIVN 447 >gb|EMJ27893.1| hypothetical protein PRUPE_ppa020602mg [Prunus persica] Length = 445 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDRGL+NTIFFIELSL+TFVLGKT+V Sbjct: 409 ITIFGWTVDRGLLNTIFFIELSLITFVLGKTLV 441 >ref|XP_006391254.1| hypothetical protein EUTSA_v10018471mg [Eutrema salsugineum] gi|557087688|gb|ESQ28540.1| hypothetical protein EUTSA_v10018471mg [Eutrema salsugineum] Length = 481 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDR LINTIFFIELSLVTFVLGKTVV Sbjct: 445 ITIFGWTVDRHLINTIFFIELSLVTFVLGKTVV 477 >ref|XP_006301293.1| hypothetical protein CARUB_v10021714mg [Capsella rubella] gi|482570003|gb|EOA34191.1| hypothetical protein CARUB_v10021714mg [Capsella rubella] Length = 447 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDR LINTIFFIELSLVTFVLGKTVV Sbjct: 411 ITIFGWTVDRHLINTIFFIELSLVTFVLGKTVV 443 >gb|AAG52311.1|AC011020_18 hypothetical protein [Arabidopsis thaliana] Length = 486 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDR LINTIFFIELSLVTFVLGKTVV Sbjct: 450 ITIFGWTVDRHLINTIFFIELSLVTFVLGKTVV 482 >ref|NP_564899.1| uncharacterized protein [Arabidopsis thaliana] gi|332196544|gb|AEE34665.1| uncharacterized protein AT1G67570 [Arabidopsis thaliana] Length = 456 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDR LINTIFFIELSLVTFVLGKTVV Sbjct: 420 ITIFGWTVDRHLINTIFFIELSLVTFVLGKTVV 452 >ref|XP_002887131.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297332972|gb|EFH63390.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 452 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDR LINTIFFIELSLVTFVLGKTVV Sbjct: 416 ITIFGWTVDRHLINTIFFIELSLVTFVLGKTVV 448 >ref|XP_002266342.1| PREDICTED: uncharacterized protein LOC100240965 [Vitis vinifera] gi|297738355|emb|CBI27556.3| unnamed protein product [Vitis vinifera] Length = 443 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDR LINTIFFIELSL+TFVLGKT+V Sbjct: 407 ITIFGWTVDRALINTIFFIELSLITFVLGKTIV 439 >gb|AAM61061.1| unknown [Arabidopsis thaliana] Length = 456 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDR LINTIFFIELSLVTFVLGKTVV Sbjct: 420 ITIFGWTVDRHLINTIFFIELSLVTFVLGKTVV 452 >ref|XP_004310198.1| PREDICTED: uncharacterized protein LOC101297985 [Fragaria vesca subsp. vesca] Length = 450 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDR L+NTIFFIELSL+TFVLGKT+V Sbjct: 414 ITIFGWTVDRALLNTIFFIELSLITFVLGKTIV 446 >ref|XP_004237697.1| PREDICTED: uncharacterized protein LOC101248293 [Solanum lycopersicum] Length = 446 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTV 96 ITIFGWTVDRGLINTIFFIEL++VTF+LGKT+ Sbjct: 390 ITIFGWTVDRGLINTIFFIELTVVTFILGKTI 421 >ref|XP_003637303.1| hypothetical protein MTR_081s0004 [Medicago truncatula] gi|355503238|gb|AES84441.1| hypothetical protein MTR_081s0004 [Medicago truncatula] Length = 65 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVVS 102 ITIFGWTVDR L+NTIFF+ELSLVTFVLG+T++S Sbjct: 32 ITIFGWTVDRSLVNTIFFLELSLVTFVLGQTLMS 65 >gb|ESW30700.1| hypothetical protein PHAVU_002G175600g [Phaseolus vulgaris] Length = 468 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDR L+NTIFF+ELSLVTFVLG+T++ Sbjct: 436 ITIFGWTVDRSLVNTIFFLELSLVTFVLGQTLI 468 >ref|XP_004504467.1| PREDICTED: uncharacterized protein LOC101499908 [Cicer arietinum] Length = 450 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVVS 102 ITIFGWTVDR L+NTIFF+ELSLVTFVLG+T+ S Sbjct: 417 ITIFGWTVDRSLVNTIFFLELSLVTFVLGQTLFS 450 >ref|XP_003531185.1| PREDICTED: uncharacterized protein LOC100813872 [Glycine max] Length = 466 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDR L+NTIFF+ELSLVTFVLG+T++ Sbjct: 434 ITIFGWTVDRSLVNTIFFLELSLVTFVLGQTLI 466 >ref|XP_003524884.1| PREDICTED: uncharacterized protein LOC100793058 [Glycine max] Length = 458 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTVDR L+NTIFF+ELSLVTFVLG+T++ Sbjct: 426 ITIFGWTVDRSLVNTIFFLELSLVTFVLGQTLI 458 >ref|XP_004142939.1| PREDICTED: uncharacterized protein LOC101221462 [Cucumis sativus] gi|449494462|ref|XP_004159552.1| PREDICTED: uncharacterized protein LOC101223780 [Cucumis sativus] Length = 444 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +1 Query: 1 ITIFGWTVDRGLINTIFFIELSLVTFVLGKTVV 99 ITIFGWTV+R L+NTIFF+EL+LVTFVLGKT+V Sbjct: 410 ITIFGWTVNRALLNTIFFLELTLVTFVLGKTLV 442