BLASTX nr result
ID: Rehmannia25_contig00018015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00018015 (451 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361680.1| PREDICTED: uncharacterized protein LOC102601... 59 9e-07 ref|XP_004250054.1| PREDICTED: uncharacterized RNA pseudouridine... 59 9e-07 gb|EPS61841.1| hypothetical protein M569_12954, partial [Genlise... 57 3e-06 >ref|XP_006361680.1| PREDICTED: uncharacterized protein LOC102601559 [Solanum tuberosum] Length = 413 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 VRIGNFRLPSDLALGKHVELTTANLRALGWKS 96 +RIG FRLP+DLALGKHVEL ANL+ALGWKS Sbjct: 382 IRIGGFRLPADLALGKHVELNQANLKALGWKS 413 >ref|XP_004250054.1| PREDICTED: uncharacterized RNA pseudouridine synthase aq_1464-like [Solanum lycopersicum] Length = 414 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 VRIGNFRLPSDLALGKHVELTTANLRALGWKS 96 +RIG FRLP+DLALGKHVEL ANL+ALGWKS Sbjct: 383 IRIGGFRLPADLALGKHVELNQANLKALGWKS 414 >gb|EPS61841.1| hypothetical protein M569_12954, partial [Genlisea aurea] Length = 273 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = +1 Query: 1 VRIGNFRLPSDLALGKHVELTTANLRALGWKS*E 102 VRIG FRLP DL LGKHVEL ANLRALGWK E Sbjct: 240 VRIGGFRLPRDLGLGKHVELNDANLRALGWKDLE 273