BLASTX nr result
ID: Rehmannia25_contig00017364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00017364 (457 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAI48083.1| MIS12 homologue [Nicotiana tabacum] gi|262263171... 55 7e-06 dbj|BAI48082.1| MIS12 homologue [Nicotiana tabacum] 55 1e-05 >dbj|BAI48083.1| MIS12 homologue [Nicotiana tabacum] gi|262263171|dbj|BAI48088.1| kinetochore protein [Nicotiana tomentosiformis] Length = 246 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/65 (43%), Positives = 42/65 (64%) Frame = -1 Query: 457 ELAVMSSEFRAKVGKLKRRMMEEIQCDRADRLRVRHGDVLRMPRNNGLFGAKLEELQQFL 278 EL +S+F++KV L RM+E+ + RA ++R +G+V R + GL A LEELQ F+ Sbjct: 179 ELVRTASDFQSKVENLATRMVEDTEHRRAKKIRTSNGEVFRSNNDEGLLSATLEELQVFV 238 Query: 277 DEITT 263 D+I T Sbjct: 239 DDIKT 243 >dbj|BAI48082.1| MIS12 homologue [Nicotiana tabacum] Length = 246 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/65 (41%), Positives = 42/65 (64%) Frame = -1 Query: 457 ELAVMSSEFRAKVGKLKRRMMEEIQCDRADRLRVRHGDVLRMPRNNGLFGAKLEELQQFL 278 EL +S+F+ KV L RM+E + RA R+R +G++ R+ + GL A LEELQ+F+ Sbjct: 179 ELVRTASDFQTKVENLATRMVENSEHRRAKRIRTSNGEMFRLSNDGGLLSATLEELQEFV 238 Query: 277 DEITT 263 ++I T Sbjct: 239 NDIKT 243