BLASTX nr result
ID: Rehmannia25_contig00017257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00017257 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006365736.1| PREDICTED: uncharacterized protein LOC102600... 62 8e-08 ref|XP_004241273.1| PREDICTED: uncharacterized protein LOC101262... 61 1e-07 ref|NP_197316.1| Methyltransferase-related protein [Arabidopsis ... 58 1e-06 ref|XP_002873874.1| hypothetical protein ARALYDRAFT_326229 [Arab... 58 1e-06 ref|XP_006479110.1| PREDICTED: uncharacterized protein LOC102620... 57 3e-06 ref|XP_006443423.1| hypothetical protein CICLE_v10022769mg [Citr... 57 3e-06 ref|XP_006286821.1| hypothetical protein CARUB_v10003766mg [Caps... 57 3e-06 ref|XP_002270086.1| PREDICTED: uncharacterized protein LOC100255... 57 3e-06 ref|XP_006400360.1| hypothetical protein EUTSA_v10015170mg [Eutr... 57 3e-06 ref|XP_006400359.1| hypothetical protein EUTSA_v10015170mg [Eutr... 57 3e-06 ref|XP_002525426.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_004489706.1| PREDICTED: uncharacterized protein LOC101509... 56 4e-06 ref|XP_006289175.1| hypothetical protein CARUB_v10002613mg [Caps... 55 1e-05 >ref|XP_006365736.1| PREDICTED: uncharacterized protein LOC102600787 [Solanum tuberosum] Length = 95 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPNLTTPEEKSS 333 MCPLRFILVFFSA+LAGYLAW+TV SSD+ + PE++++ Sbjct: 1 MCPLRFILVFFSALLAGYLAWRTVRSSDDLDFAIPEDETT 40 >ref|XP_004241273.1| PREDICTED: uncharacterized protein LOC101262017 [Solanum lycopersicum] Length = 95 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPNLTTPEEKSS 333 MCPLRFILVFFSA+LAGYLAW+TV SSD+ + P+++++ Sbjct: 1 MCPLRFILVFFSALLAGYLAWRTVRSSDDLDFANPDDETT 40 >ref|NP_197316.1| Methyltransferase-related protein [Arabidopsis thaliana] gi|9758897|dbj|BAB09473.1| unnamed protein product [Arabidopsis thaliana] gi|26452603|dbj|BAC43385.1| unknown protein [Arabidopsis thaliana] gi|28973485|gb|AAO64067.1| unknown protein [Arabidopsis thaliana] gi|332005130|gb|AED92513.1| Methyltransferase-related protein [Arabidopsis thaliana] Length = 76 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPNLTTPEE 324 MCP+RF+LVFFSAVLAGY AWKTVSSS P +P+E Sbjct: 1 MCPMRFLLVFFSAVLAGYFAWKTVSSS--PEFDSPDE 35 >ref|XP_002873874.1| hypothetical protein ARALYDRAFT_326229 [Arabidopsis lyrata subsp. lyrata] gi|297319711|gb|EFH50133.1| hypothetical protein ARALYDRAFT_326229 [Arabidopsis lyrata subsp. lyrata] Length = 76 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPNLTTPEE 324 MCP+RF+LVFFSAVLAGY AWKTVSSS P +P+E Sbjct: 1 MCPMRFLLVFFSAVLAGYFAWKTVSSS--PEFDSPDE 35 >ref|XP_006479110.1| PREDICTED: uncharacterized protein LOC102620725 [Citrus sinensis] Length = 84 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/45 (62%), Positives = 34/45 (75%), Gaps = 5/45 (11%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPNLT-----TPEEKSS 333 MCPLRFILVFFSAVLAGY AW+TV SS E ++ +P +K+S Sbjct: 1 MCPLRFILVFFSAVLAGYFAWRTVRSSPEADINSLSDDSPNDKTS 45 >ref|XP_006443423.1| hypothetical protein CICLE_v10022769mg [Citrus clementina] gi|557545685|gb|ESR56663.1| hypothetical protein CICLE_v10022769mg [Citrus clementina] Length = 140 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/45 (62%), Positives = 34/45 (75%), Gaps = 5/45 (11%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPNLT-----TPEEKSS 333 MCPLRFILVFFSAVLAGY AW+TV SS E ++ +P +K+S Sbjct: 57 MCPLRFILVFFSAVLAGYFAWRTVRSSPEADINSLSDDSPNDKTS 101 >ref|XP_006286821.1| hypothetical protein CARUB_v10003766mg [Capsella rubella] gi|482555527|gb|EOA19719.1| hypothetical protein CARUB_v10003766mg [Capsella rubella] Length = 79 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDE 300 MCPLRF+LVFFSAVLAGY AWKTVSSS E Sbjct: 1 MCPLRFLLVFFSAVLAGYFAWKTVSSSPE 29 >ref|XP_002270086.1| PREDICTED: uncharacterized protein LOC100255594 [Vitis vinifera] gi|296084605|emb|CBI25626.3| unnamed protein product [Vitis vinifera] Length = 88 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPNLTTPEEKSSTI 339 MCPLRFILVFFSAVLAGY AW+TV SS E L+ + + Sbjct: 1 MCPLRFILVFFSAVLAGYFAWRTVRSSQETGLSLEDSNLENV 42 >ref|XP_006400360.1| hypothetical protein EUTSA_v10015170mg [Eutrema salsugineum] gi|557101450|gb|ESQ41813.1| hypothetical protein EUTSA_v10015170mg [Eutrema salsugineum] Length = 79 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPN 306 MCPLRF+LVFFSA+LAGY AWKTVSSS + N Sbjct: 1 MCPLRFLLVFFSAILAGYFAWKTVSSSPDLN 31 >ref|XP_006400359.1| hypothetical protein EUTSA_v10015170mg [Eutrema salsugineum] gi|557101449|gb|ESQ41812.1| hypothetical protein EUTSA_v10015170mg [Eutrema salsugineum] Length = 78 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPN 306 MCPLRF+LVFFSA+LAGY AWKTVSSS + N Sbjct: 1 MCPLRFLLVFFSAILAGYFAWKTVSSSPDLN 31 >ref|XP_002525426.1| conserved hypothetical protein [Ricinus communis] gi|223535239|gb|EEF36916.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPNLTTPEEKS 330 MCPLRFILVFFSAVLAGY AW+TV SS E T ++ + Sbjct: 1 MCPLRFILVFFSAVLAGYFAWRTVRSSPEIETTVSDDST 39 >ref|XP_004489706.1| PREDICTED: uncharacterized protein LOC101509787 [Cicer arietinum] Length = 88 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/44 (65%), Positives = 34/44 (77%), Gaps = 4/44 (9%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPNL----TTPEEKSS 333 MCPLRFILVFFSAVLAGY AW+TV+SS + L + +EKSS Sbjct: 1 MCPLRFILVFFSAVLAGYFAWRTVNSSPKIELVSDDSVEDEKSS 44 >ref|XP_006289175.1| hypothetical protein CARUB_v10002613mg [Capsella rubella] gi|482557881|gb|EOA22073.1| hypothetical protein CARUB_v10002613mg [Capsella rubella] Length = 80 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 214 MCPLRFILVFFSAVLAGYLAWKTVSSSDEPNLTTPE 321 MCPLRF+LVFFSAVLAGY+AW+TV+SS P+L + E Sbjct: 1 MCPLRFVLVFFSAVLAGYMAWRTVNSS--PDLFSDE 34