BLASTX nr result
ID: Rehmannia25_contig00017158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00017158 (624 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610724.1| Cysteine synthase [Medicago truncatula] gi|3... 61 3e-07 ref|XP_003610723.1| Cysteine synthase [Medicago truncatula] gi|2... 61 3e-07 ref|XP_004511361.1| PREDICTED: cysteine synthase-like isoform X1... 60 7e-07 gb|EMJ23876.1| hypothetical protein PRUPE_ppa008606mg [Prunus pe... 60 7e-07 emb|CAA06819.1| cysteine synthase, O-acetyl-L-serine (thiol)-lya... 60 7e-07 gb|AFK39569.1| unknown [Medicago truncatula] 59 1e-06 gb|ESW29121.1| hypothetical protein PHAVU_002G045200g [Phaseolus... 58 2e-06 gb|EPS66048.1| cysteine synthase [Genlisea aurea] 58 2e-06 ref|XP_002517133.1| cysteine synthase, putative [Ricinus communi... 58 2e-06 ref|NP_001235628.1| cysteine synthase [Glycine max] gi|18252506|... 58 3e-06 gb|ABQ02253.1| O-acetylserine (thiol)lyase [Glycine soja] 58 3e-06 ref|XP_002311629.1| O-acetylserine (thiol)lyase family protein [... 57 3e-06 ref|XP_006650579.1| PREDICTED: cysteine synthase-like isoform X1... 57 4e-06 gb|ABW24494.1| O-acetylserine(thiol)-lyase [Sesamum indicum] 57 4e-06 ref|XP_002275990.1| PREDICTED: cysteine synthase isoform 2 [Viti... 57 4e-06 ref|XP_002512253.1| cysteine synthase, putative [Ricinus communi... 57 6e-06 gb|EOY05690.1| Cysteine synthase [Theobroma cacao] 56 7e-06 emb|CAJ32462.1| putative cytosolic cysteine synthase 7 [Nicotian... 56 7e-06 gb|AAR18402.1| cysteine synthase [Nicotiana plumbaginifolia] 56 7e-06 ref|XP_006419940.1| hypothetical protein CICLE_v10005422mg [Citr... 56 1e-05 >ref|XP_003610724.1| Cysteine synthase [Medicago truncatula] gi|355512059|gb|AES93682.1| Cysteine synthase [Medicago truncatula] Length = 284 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 V+FPSFGERYLSSVLF+SVRREAETMTFEP Sbjct: 255 VVFPSFGERYLSSVLFESVRREAETMTFEP 284 >ref|XP_003610723.1| Cysteine synthase [Medicago truncatula] gi|217074042|gb|ACJ85381.1| unknown [Medicago truncatula] gi|355512058|gb|AES93681.1| Cysteine synthase [Medicago truncatula] Length = 325 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 V+FPSFGERYLSSVLF+SVRREAETMTFEP Sbjct: 296 VVFPSFGERYLSSVLFESVRREAETMTFEP 325 >ref|XP_004511361.1| PREDICTED: cysteine synthase-like isoform X1 [Cicer arietinum] gi|502159006|ref|XP_004511362.1| PREDICTED: cysteine synthase-like isoform X2 [Cicer arietinum] Length = 325 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 V+FPSFGERYLSSVLF+SVRR+AETMTFEP Sbjct: 296 VVFPSFGERYLSSVLFESVRRQAETMTFEP 325 >gb|EMJ23876.1| hypothetical protein PRUPE_ppa008606mg [Prunus persica] Length = 325 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 VIFPSFGERYLSSVLF+SVRREAE+MTFEP Sbjct: 296 VIFPSFGERYLSSVLFESVRREAESMTFEP 325 >emb|CAA06819.1| cysteine synthase, O-acetyl-L-serine (thiol)-lyase [Cicer arietinum] Length = 266 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 V+FPSFGERYLSSVLF+SVRR+AETMTFEP Sbjct: 237 VVFPSFGERYLSSVLFESVRRQAETMTFEP 266 >gb|AFK39569.1| unknown [Medicago truncatula] Length = 325 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 V+FPS GERYLSSVLF+SVRREAETMTFEP Sbjct: 296 VVFPSLGERYLSSVLFESVRREAETMTFEP 325 >gb|ESW29121.1| hypothetical protein PHAVU_002G045200g [Phaseolus vulgaris] Length = 325 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 523 IFPSFGERYLSSVLFDSVRREAETMTFEP 609 +FPSFGERYLS+VLF+SVRREAETMTFEP Sbjct: 297 VFPSFGERYLSTVLFESVRREAETMTFEP 325 >gb|EPS66048.1| cysteine synthase [Genlisea aurea] Length = 325 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 VIFPSFGERYLSSVLF+SVR+EAE MTFEP Sbjct: 296 VIFPSFGERYLSSVLFESVRKEAEAMTFEP 325 >ref|XP_002517133.1| cysteine synthase, putative [Ricinus communis] gi|223543768|gb|EEF45296.1| cysteine synthase, putative [Ricinus communis] Length = 325 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 V+FPSFGERYLSSVLF+SVRREAE+MT+EP Sbjct: 296 VVFPSFGERYLSSVLFESVRREAESMTYEP 325 >ref|NP_001235628.1| cysteine synthase [Glycine max] gi|18252506|gb|AAL66291.1|AF452451_1 cysteine synthase [Glycine max] Length = 325 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 523 IFPSFGERYLSSVLFDSVRREAETMTFEP 609 +FPSFGERYLSSVLF+SVRREAE+MTFEP Sbjct: 297 VFPSFGERYLSSVLFESVRREAESMTFEP 325 >gb|ABQ02253.1| O-acetylserine (thiol)lyase [Glycine soja] Length = 325 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 523 IFPSFGERYLSSVLFDSVRREAETMTFEP 609 +FPSFGERYLSSVLF+SVRREAE+MTFEP Sbjct: 297 VFPSFGERYLSSVLFESVRREAESMTFEP 325 >ref|XP_002311629.1| O-acetylserine (thiol)lyase family protein [Populus trichocarpa] gi|222851449|gb|EEE88996.1| O-acetylserine (thiol)lyase family protein [Populus trichocarpa] Length = 325 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 V+FPSFGERYLSSVLFDSV+REAE+M FEP Sbjct: 296 VVFPSFGERYLSSVLFDSVKREAESMKFEP 325 >ref|XP_006650579.1| PREDICTED: cysteine synthase-like isoform X1 [Oryza brachyantha] gi|573926089|ref|XP_006650580.1| PREDICTED: cysteine synthase-like isoform X2 [Oryza brachyantha] gi|573926091|ref|XP_006650581.1| PREDICTED: cysteine synthase-like isoform X3 [Oryza brachyantha] Length = 325 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 V+FPSFGERYLSSVLFDS++REAE M FEP Sbjct: 296 VVFPSFGERYLSSVLFDSIKREAENMVFEP 325 >gb|ABW24494.1| O-acetylserine(thiol)-lyase [Sesamum indicum] Length = 325 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 VIFPSFGERYLSSVLF+SVRREAE+MT EP Sbjct: 296 VIFPSFGERYLSSVLFESVRREAESMTVEP 325 >ref|XP_002275990.1| PREDICTED: cysteine synthase isoform 2 [Vitis vinifera] gi|225451237|ref|XP_002275940.1| PREDICTED: cysteine synthase isoform 1 [Vitis vinifera] gi|359487829|ref|XP_003633658.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|147819267|emb|CAN75607.1| hypothetical protein VITISV_033255 [Vitis vinifera] gi|298204909|emb|CBI34216.3| unnamed protein product [Vitis vinifera] Length = 325 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 V+FPSFGERYLSSVLFDSV+REAE M FEP Sbjct: 296 VVFPSFGERYLSSVLFDSVKREAENMLFEP 325 >ref|XP_002512253.1| cysteine synthase, putative [Ricinus communis] gi|223548214|gb|EEF49705.1| cysteine synthase, putative [Ricinus communis] Length = 325 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 VIFPSFGERYLSSVLF+SV+REAE+M FEP Sbjct: 296 VIFPSFGERYLSSVLFESVKREAESMVFEP 325 >gb|EOY05690.1| Cysteine synthase [Theobroma cacao] Length = 325 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 523 IFPSFGERYLSSVLFDSVRREAETMTFEP 609 IFPSFGERYLSSVLF+SVR EAE+MTFEP Sbjct: 297 IFPSFGERYLSSVLFESVREEAESMTFEP 325 >emb|CAJ32462.1| putative cytosolic cysteine synthase 7 [Nicotiana tabacum] gi|530704739|gb|AGT40334.1| O-acetylserine thiol-lyase [Nicotiana attenuata] Length = 325 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 V+FPSFGERYLSSVLF+SVRREAE MT EP Sbjct: 296 VVFPSFGERYLSSVLFESVRREAENMTVEP 325 >gb|AAR18402.1| cysteine synthase [Nicotiana plumbaginifolia] Length = 323 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFEP 609 V+FPSFGERYLSSVLF+SVRREAE MT EP Sbjct: 294 VVFPSFGERYLSSVLFESVRREAENMTVEP 323 >ref|XP_006419940.1| hypothetical protein CICLE_v10005422mg [Citrus clementina] gi|568872470|ref|XP_006489391.1| PREDICTED: cysteine synthase-like isoform X1 [Citrus sinensis] gi|568872472|ref|XP_006489392.1| PREDICTED: cysteine synthase-like isoform X2 [Citrus sinensis] gi|568872474|ref|XP_006489393.1| PREDICTED: cysteine synthase-like isoform X3 [Citrus sinensis] gi|568872476|ref|XP_006489394.1| PREDICTED: cysteine synthase-like isoform X4 [Citrus sinensis] gi|557521813|gb|ESR33180.1| hypothetical protein CICLE_v10005422mg [Citrus clementina] Length = 325 Score = 55.8 bits (133), Expect = 1e-05 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 520 VIFPSFGERYLSSVLFDSVRREAETMTFE 606 VIFPSFGERYLSSVLF+SVR+EAE+MTFE Sbjct: 296 VIFPSFGERYLSSVLFESVRKEAESMTFE 324