BLASTX nr result
ID: Rehmannia25_contig00017015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00017015 (499 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF64710.1| putative transposase [Ipomoea tricolor] 47 2e-07 >dbj|BAF64710.1| putative transposase [Ipomoea tricolor] Length = 517 Score = 46.6 bits (109), Expect(2) = 2e-07 Identities = 17/43 (39%), Positives = 31/43 (72%) Frame = -1 Query: 292 MFRYRMQLQVVDQTGNASLLCWDRDCEKLIGIPCSELRKSLTE 164 + RYR++++ VD GNA + WD++C +L+GI ++LR+ + E Sbjct: 342 ILRYRVKVRAVDLDGNAPFILWDKECTELLGISATDLRQKILE 384 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -2 Query: 489 EWWYLSCKK--CPKNLTKAGEKFYCERCDAFYTSGNFRY 379 +W+Y+SCK C K LT + C++C + G RY Sbjct: 307 DWFYVSCKSHGCNKKLTLRNTLYDCDKCKRTWQEGILRY 345