BLASTX nr result
ID: Rehmannia25_contig00016776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00016776 (397 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74526.1| hypothetical protein M569_00243, partial [Genlise... 116 3e-24 emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] 99 4e-19 dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] 96 6e-18 ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulg... 56 4e-06 >gb|EPS74526.1| hypothetical protein M569_00243, partial [Genlisea aurea] Length = 66 Score = 116 bits (291), Expect = 3e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -3 Query: 395 SKGSRRPTKVRKPGSFRKRIPIRRVHNCMDKLTLTRQFGIQFDIFLGRYREGIGME 228 SKGSRRPTKVRKPGSFRKRIPIRRVHNCMDKLTLTRQFGI+FDIFLGRYREGIGME Sbjct: 11 SKGSRRPTKVRKPGSFRKRIPIRRVHNCMDKLTLTRQFGIKFDIFLGRYREGIGME 66 >emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] Length = 142 Score = 99.4 bits (246), Expect = 4e-19 Identities = 49/55 (89%), Positives = 49/55 (89%) Frame = -3 Query: 395 SKGSRRPTKVRKPGSFRKRIPIRRVHNCMDKLTLTRQFGIQFDIFLGRYREGIGM 231 SKGSRRPTK RK GSFRK IPIRRVHN MDKLTLTRQFGI F IFLGRYREGIGM Sbjct: 88 SKGSRRPTKARKSGSFRKWIPIRRVHNRMDKLTLTRQFGIHFGIFLGRYREGIGM 142 >dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] Length = 174 Score = 95.5 bits (236), Expect = 6e-18 Identities = 49/56 (87%), Positives = 50/56 (89%), Gaps = 1/56 (1%) Frame = -3 Query: 395 SKGSRRPTKVRKPGSFRKRIPIRRVHNCMDKLTLTRQFG-IQFDIFLGRYREGIGM 231 SKGSRRPTK RKPGS RK IPIRRVHN MDKLTLTRQFG IQF IFLGRYR+GIGM Sbjct: 119 SKGSRRPTKARKPGSVRKWIPIRRVHNRMDKLTLTRQFGMIQFGIFLGRYRKGIGM 174 >ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435087|ref|YP_004222305.1| hypothetical protein BevumaM_p070 [Beta vulgaris subsp. maritima] gi|346683178|ref|YP_004842110.1| hypothetical protein BemaM_p065 [Beta macrocarpa] gi|9049278|dbj|BAA99288.1| orf114a [Beta vulgaris subsp. vulgaris] gi|317905640|emb|CBJ14041.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439820|emb|CBJ17532.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500096|emb|CBX24914.1| hypothetical protein [Beta macrocarpa] gi|384977899|emb|CBL54123.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 114 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 310 MQLCTLRIGIRFLKDPGFRTLVGLRDPFD 396 M+LCTLRIGI FL DPGFR LVGLRDPFD Sbjct: 1 MRLCTLRIGIHFLTDPGFRALVGLRDPFD 29