BLASTX nr result
ID: Rehmannia25_contig00016339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00016339 (704 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU24529.1| unknown [Glycine max] 51 2e-10 ref|XP_003536697.1| PREDICTED: vesicle-associated membrane prote... 50 3e-10 gb|ACU23563.1| unknown [Glycine max] 50 6e-10 gb|ESW14859.1| hypothetical protein PHAVU_007G023300g [Phaseolus... 49 1e-09 ref|XP_003555880.1| PREDICTED: vesicle-associated membrane prote... 48 1e-09 gb|EOY19233.1| Vesicle-associated membrane protein 727 [Theobrom... 50 2e-09 ref|XP_006485186.1| PREDICTED: vesicle-associated membrane prote... 48 6e-09 ref|XP_003637224.1| Vesicle-associated membrane protein [Medicag... 47 6e-09 ref|XP_006445743.1| hypothetical protein CICLE_v10016922mg [Citr... 48 8e-09 ref|XP_004306429.1| PREDICTED: vesicle-associated membrane prote... 46 2e-08 ref|XP_002515759.1| Vesicle-associated membrane protein, putativ... 47 3e-08 gb|EMJ19494.1| hypothetical protein PRUPE_ppa010737mg [Prunus pe... 45 6e-08 ref|XP_002311006.1| Vesicle-associated membrane protein 727 [Pop... 45 6e-08 gb|AFK42000.1| unknown [Lotus japonicus] 42 6e-08 ref|XP_004497141.1| PREDICTED: vesicle-associated membrane prote... 44 7e-08 ref|XP_006403590.1| hypothetical protein EUTSA_v10010674mg [Eutr... 45 1e-07 ref|XP_006291777.1| hypothetical protein CARUB_v10017948mg [Caps... 45 1e-07 ref|XP_002877968.1| ATVAMP727 [Arabidopsis lyrata subsp. lyrata]... 45 1e-07 ref|XP_002269134.1| PREDICTED: vesicle-associated membrane prote... 44 1e-07 ref|NP_190998.1| vesicle-associated membrane protein 727 [Arabid... 45 1e-07 >gb|ACU24529.1| unknown [Glycine max] Length = 238 Score = 50.8 bits (120), Expect(3) = 2e-10 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 16/77 (20%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VFVVADESMGGSIPFVFLEKVK-------GV 352 LQKLPS+ + CDG FL + FVV DES+G S+PFVFLE+VK G Sbjct: 36 LQKLPSNSSKYTYSCDGHTFNFLLDNGFVFFVVTDESIGRSVPFVFLERVKDDFMKRYGA 95 Query: 351 MVRT--L*PIVDDEDDD 307 ++ P+ DDEDDD Sbjct: 96 SIKNDGAHPLADDEDDD 112 Score = 30.8 bits (68), Expect(3) = 2e-10 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 29.6 bits (65), Expect(3) = 2e-10 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG A+++ Sbjct: 115 FEDRFSIAYNLDREFGPALKE 135 >ref|XP_003536697.1| PREDICTED: vesicle-associated membrane protein 727-like isoform X1 [Glycine max] gi|571484986|ref|XP_006589712.1| PREDICTED: vesicle-associated membrane protein 727-like isoform X2 [Glycine max] gi|571484988|ref|XP_006589713.1| PREDICTED: vesicle-associated membrane protein 727-like isoform X3 [Glycine max] Length = 238 Score = 50.4 bits (119), Expect(3) = 3e-10 Identities = 38/78 (48%), Positives = 46/78 (58%), Gaps = 17/78 (21%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------G 355 LQKLPS+ + CDG FL D VF VVADES+G S+PFVFLE+VK G Sbjct: 36 LQKLPSNSSKYTYSCDGHTFNFLL-DNGFVFLVVADESIGRSVPFVFLERVKDDFMKRYG 94 Query: 354 VMVRT--L*PIVDDEDDD 307 ++ P+ DDEDDD Sbjct: 95 ASIKNDGAHPLADDEDDD 112 Score = 30.8 bits (68), Expect(3) = 3e-10 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 29.6 bits (65), Expect(3) = 3e-10 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG A+++ Sbjct: 115 FEDRFSIAYNLDREFGPALKE 135 >gb|ACU23563.1| unknown [Glycine max] Length = 238 Score = 49.7 bits (117), Expect(3) = 6e-10 Identities = 38/78 (48%), Positives = 46/78 (58%), Gaps = 17/78 (21%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------G 355 LQKLPS+ + CDG FL D VF VVADES G S+PFVFLE+VK G Sbjct: 36 LQKLPSNSSKYTYSCDGHTFNFLL-DTGFVFLVVADESAGRSVPFVFLERVKDDFMKRYG 94 Query: 354 VMVRT--L*PIVDDEDDD 307 V ++ P+ DD+DDD Sbjct: 95 VSIKNEGAHPLADDDDDD 112 Score = 30.4 bits (67), Expect(3) = 6e-10 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KG+M+DNIEKV Sbjct: 155 AQITEVKGVMMDNIEKV 171 Score = 29.6 bits (65), Expect(3) = 6e-10 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG A+++ Sbjct: 115 FEDRFSIAYNLDREFGPALKE 135 >gb|ESW14859.1| hypothetical protein PHAVU_007G023300g [Phaseolus vulgaris] Length = 238 Score = 48.5 bits (114), Expect(3) = 1e-09 Identities = 37/81 (45%), Positives = 45/81 (55%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVKGVMVRTL* 334 LQKLPS+ + CDG FL D VF VVADES+G S+PFVFLE+VK ++ Sbjct: 36 LQKLPSNSSKYTYSCDGHTFNFLI-DNGFVFLVVADESVGRSVPFVFLERVKDDFMKRYG 94 Query: 333 PIV----------DDEDDDFF 301 + DDEDDD F Sbjct: 95 ASINNGSTHPLADDDEDDDLF 115 Score = 30.8 bits (68), Expect(3) = 1e-09 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 29.6 bits (65), Expect(3) = 1e-09 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG A+++ Sbjct: 115 FEDRFSIAYNLDREFGPALKE 135 >ref|XP_003555880.1| PREDICTED: vesicle-associated membrane protein 727-like [Glycine max] Length = 238 Score = 48.1 bits (113), Expect(3) = 1e-09 Identities = 37/78 (47%), Positives = 45/78 (57%), Gaps = 17/78 (21%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------G 355 LQKLPS+ + CDG FL D VF VVADES G S+PFVFLE+VK G Sbjct: 36 LQKLPSNSSKYTYSCDGHTFNFLL-DTGFVFLVVADESAGRSVPFVFLERVKDDFMKRYG 94 Query: 354 VMVRT--L*PIVDDEDDD 307 ++ P+ DD+DDD Sbjct: 95 ASIKNEGAHPLADDDDDD 112 Score = 30.8 bits (68), Expect(3) = 1e-09 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 29.6 bits (65), Expect(3) = 1e-09 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG A+++ Sbjct: 115 FEDRFSIAYNLDREFGPALKE 135 >gb|EOY19233.1| Vesicle-associated membrane protein 727 [Theobroma cacao] Length = 238 Score = 49.7 bits (117), Expect(3) = 2e-09 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------G 355 LQKLPS+ F CDG FL D VF VVADES+G S+PFVFLE+V+ G Sbjct: 36 LQKLPSNSSKFTYSCDGHTFNFLI-DNGFVFLVVADESVGRSVPFVFLERVQDDFKQRYG 94 Query: 354 VMVRT--L*PIV-DDEDDDFF 301 ++ L P+ DDEDDD F Sbjct: 95 ASIKNEGLHPLADDDEDDDLF 115 Score = 30.8 bits (68), Expect(3) = 2e-09 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 27.7 bits (60), Expect(3) = 2e-09 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG +++ Sbjct: 115 FEDRFSIAYNLDREFGPRLKE 135 >ref|XP_006485186.1| PREDICTED: vesicle-associated membrane protein 727-like [Citrus sinensis] Length = 238 Score = 47.8 bits (112), Expect(3) = 6e-09 Identities = 38/81 (46%), Positives = 45/81 (55%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------- 358 LQKLP+S + CDG FL D VF VVADES+G S+PFVFLE+VK Sbjct: 36 LQKLPASSSKYTYSCDGHTFNFLL-DSGFVFLVVADESVGRSVPFVFLERVKDDFKQRYG 94 Query: 357 -GVMVRTL*PIV-DDEDDDFF 301 + P+ DDEDDD F Sbjct: 95 ASIQNEESHPLADDDEDDDLF 115 Score = 30.8 bits (68), Expect(3) = 6e-09 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 27.7 bits (60), Expect(3) = 6e-09 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG +++ Sbjct: 115 FEDRFSIAYNLDREFGPRLKE 135 >ref|XP_003637224.1| Vesicle-associated membrane protein [Medicago truncatula] gi|355503159|gb|AES84362.1| Vesicle-associated membrane protein [Medicago truncatula] Length = 238 Score = 47.4 bits (111), Expect(3) = 6e-09 Identities = 37/81 (45%), Positives = 46/81 (56%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------- 358 L KLPS+ + CDG FL D VF VVADES+G S+PFVFLE+VK Sbjct: 36 LNKLPSNSTKYTYSCDGHTFNFLL-DNGFVFLVVADESIGRSVPFVFLERVKDDFNQRYG 94 Query: 357 -GVMVRTL*PIV-DDEDDDFF 301 + + + P+ DDEDDD F Sbjct: 95 ASIKIASDHPLADDDEDDDLF 115 Score = 30.8 bits (68), Expect(3) = 6e-09 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 28.1 bits (61), Expect(3) = 6e-09 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMR 243 F+DR SIAYN REFG +++ Sbjct: 115 FEDRFSIAYNLDREFGPSLK 134 >ref|XP_006445743.1| hypothetical protein CICLE_v10016922mg [Citrus clementina] gi|557548354|gb|ESR58983.1| hypothetical protein CICLE_v10016922mg [Citrus clementina] Length = 176 Score = 47.8 bits (112), Expect(3) = 8e-09 Identities = 38/81 (46%), Positives = 45/81 (55%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------- 358 LQKLP+S + CDG FL D VF VVADES+G S+PFVFLE+VK Sbjct: 36 LQKLPASSSKYTYSCDGHTFNFLL-DSGFVFLVVADESVGRSVPFVFLERVKDDFKQRYG 94 Query: 357 -GVMVRTL*PIV-DDEDDDFF 301 + P+ DDEDDD F Sbjct: 95 ASIQNEESHPLADDDEDDDLF 115 Score = 30.4 bits (67), Expect(3) = 8e-09 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEK+ Sbjct: 155 AQITEVKGIMMDNIEKI 171 Score = 27.7 bits (60), Expect(3) = 8e-09 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG +++ Sbjct: 115 FEDRFSIAYNLDREFGPRLKE 135 >ref|XP_004306429.1| PREDICTED: vesicle-associated membrane protein 727-like [Fragaria vesca subsp. vesca] Length = 238 Score = 46.2 bits (108), Expect(3) = 2e-08 Identities = 37/81 (45%), Positives = 44/81 (54%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVKGVMVRTL* 334 LQKLPSS CDG FL D VF VVADES+G S+PFVFLE+VK ++ Sbjct: 36 LQKLPSSTTKSTYSCDGHTFNFLL-DNGFVFLVVADESVGRSVPFVFLERVKADFMQRYA 94 Query: 333 PIV----------DDEDDDFF 301 P + +DEDD F Sbjct: 95 PSIKNEGPHPLADEDEDDALF 115 Score = 30.4 bits (67), Expect(3) = 2e-08 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KG+M+DNIEKV Sbjct: 155 AQITEVKGVMMDNIEKV 171 Score = 27.7 bits (60), Expect(3) = 2e-08 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG +++ Sbjct: 115 FEDRFSIAYNLDREFGPKLKE 135 >ref|XP_002515759.1| Vesicle-associated membrane protein, putative [Ricinus communis] gi|223545087|gb|EEF46598.1| Vesicle-associated membrane protein, putative [Ricinus communis] Length = 237 Score = 47.4 bits (111), Expect(3) = 3e-08 Identities = 37/77 (48%), Positives = 44/77 (57%), Gaps = 16/77 (20%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------G 355 LQKLPS+ + CDG FL D VF VVADES G S+PFVFLE+VK G Sbjct: 36 LQKLPSNSSKYTYSCDGHTFNFLI-DSGFVFLVVADESTGRSVPFVFLERVKDDFKQRYG 94 Query: 354 VMVRT-L*PIVDDEDDD 307 + P+ DD+DDD Sbjct: 95 AGINNEAHPLADDDDDD 111 Score = 30.8 bits (68), Expect(3) = 3e-08 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 154 AQITEVKGIMMDNIEKV 170 Score = 25.8 bits (55), Expect(3) = 3e-08 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F DR SIAYN R+FG +++ Sbjct: 114 FADRFSIAYNLDRDFGPRLKE 134 >gb|EMJ19494.1| hypothetical protein PRUPE_ppa010737mg [Prunus persica] Length = 238 Score = 44.7 bits (104), Expect(3) = 6e-08 Identities = 38/81 (46%), Positives = 44/81 (54%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------- 358 LQKLPSS + CD FL D VF VVADES+G S+PFVFLE+VK Sbjct: 36 LQKLPSSSSKYTYACDSHTFNFLL-DNGFVFLVVADESVGRSMPFVFLERVKEDFKQRYG 94 Query: 357 -GVMVRTL*PIVDD-EDDDFF 301 + P+ DD EDDD F Sbjct: 95 SNNKIEGPHPLADDNEDDDLF 115 Score = 30.4 bits (67), Expect(3) = 6e-08 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KG+M+DNIEKV Sbjct: 155 AQITEVKGVMMDNIEKV 171 Score = 27.7 bits (60), Expect(3) = 6e-08 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG +++ Sbjct: 115 FEDRFSIAYNLDREFGPRLKE 135 >ref|XP_002311006.1| Vesicle-associated membrane protein 727 [Populus trichocarpa] gi|222850826|gb|EEE88373.1| Vesicle-associated membrane protein 727 [Populus trichocarpa] Length = 238 Score = 44.7 bits (104), Expect(3) = 6e-08 Identities = 34/77 (44%), Positives = 42/77 (54%), Gaps = 16/77 (20%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VFV-VADESMGGSIPFVFLEKVK-------- 358 LQKLPS+ + CDG FL D VF+ VADES G +PFVFLE+VK Sbjct: 37 LQKLPSNSSKYTYSCDGHTFNFLI-DNGFVFLAVADESAGRGLPFVFLERVKDDFKQRYS 95 Query: 357 GVMVRTL*PIVDDEDDD 307 + P+ DD+DDD Sbjct: 96 ASIKNEAHPLADDDDDD 112 Score = 30.8 bits (68), Expect(3) = 6e-08 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 27.3 bits (59), Expect(3) = 6e-08 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR S+AYN REFG +++ Sbjct: 115 FEDRFSVAYNLDREFGPRLKE 135 >gb|AFK42000.1| unknown [Lotus japonicus] Length = 207 Score = 42.4 bits (98), Expect(3) = 6e-08 Identities = 30/64 (46%), Positives = 37/64 (57%), Gaps = 14/64 (21%) Frame = -3 Query: 456 CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVKGVMVRTL---------*PIVDD 319 CDG FL D VF VVADES+G S+PFVFLE+VK ++ P+ DD Sbjct: 19 CDGHTFNFLL-DNGFVFLVVADESVGRSVPFVFLERVKDDFMQRYGASIENASDHPLADD 77 Query: 318 EDDD 307 +DDD Sbjct: 78 DDDD 81 Score = 30.8 bits (68), Expect(3) = 6e-08 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 124 AQITEVKGIMMDNIEKV 140 Score = 29.6 bits (65), Expect(3) = 6e-08 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG A+++ Sbjct: 84 FEDRFSIAYNLDREFGPALKE 104 >ref|XP_004497141.1| PREDICTED: vesicle-associated membrane protein 727-like [Cicer arietinum] Length = 238 Score = 44.3 bits (103), Expect(3) = 7e-08 Identities = 37/81 (45%), Positives = 46/81 (56%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------G 355 L KLPS+ + CD FL D VF VVADES+G S+PFVFLE+VK G Sbjct: 36 LNKLPSNSTKYTYSCDAHTFNFLL-DNGFVFLVVADESIGRSVPFVFLERVKDDFKQRYG 94 Query: 354 VMVRTL--*PIV-DDEDDDFF 301 +++ P+ DDEDDD F Sbjct: 95 ASIKSASDHPLADDDEDDDLF 115 Score = 30.8 bits (68), Expect(3) = 7e-08 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 27.3 bits (59), Expect(3) = 7e-08 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 302 FKDRLSIAYNPVREFG 255 F+DR SIAYN REFG Sbjct: 115 FEDRFSIAYNLDREFG 130 >ref|XP_006403590.1| hypothetical protein EUTSA_v10010674mg [Eutrema salsugineum] gi|567186683|ref|XP_006403591.1| hypothetical protein EUTSA_v10010674mg [Eutrema salsugineum] gi|567186686|ref|XP_006403592.1| hypothetical protein EUTSA_v10010674mg [Eutrema salsugineum] gi|557104709|gb|ESQ45043.1| hypothetical protein EUTSA_v10010674mg [Eutrema salsugineum] gi|557104710|gb|ESQ45044.1| hypothetical protein EUTSA_v10010674mg [Eutrema salsugineum] gi|557104711|gb|ESQ45045.1| hypothetical protein EUTSA_v10010674mg [Eutrema salsugineum] Length = 240 Score = 44.7 bits (104), Expect(3) = 1e-07 Identities = 36/81 (44%), Positives = 43/81 (53%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVKGVMVRTL* 334 LQKLP++ + CDG FL D VF VVADES G S+PFVFLE+VK + Sbjct: 36 LQKLPTNSSKYTYSCDGHTFNFLV-DNGFVFLVVADESTGRSVPFVFLERVKEDFKKRYE 94 Query: 333 PIV----------DDEDDDFF 301 + DDEDDD F Sbjct: 95 GSIKNDEPHPLADDDEDDDLF 115 Score = 30.8 bits (68), Expect(3) = 1e-07 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 26.6 bits (57), Expect(3) = 1e-07 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F DR SIAYN REFG +++ Sbjct: 115 FGDRFSIAYNLDREFGPILKE 135 >ref|XP_006291777.1| hypothetical protein CARUB_v10017948mg [Capsella rubella] gi|482560484|gb|EOA24675.1| hypothetical protein CARUB_v10017948mg [Capsella rubella] Length = 240 Score = 44.7 bits (104), Expect(3) = 1e-07 Identities = 36/81 (44%), Positives = 43/81 (53%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVKGVMVRTL* 334 LQKLP++ + CDG FL D VF VVADES G S+PFVFLE+VK + Sbjct: 36 LQKLPNNSSKYTYSCDGHTFNFLI-DNGFVFLVVADESTGRSVPFVFLERVKEDFNKRYE 94 Query: 333 PIV----------DDEDDDFF 301 + DDEDDD F Sbjct: 95 ASIKNDEKHPLADDDEDDDLF 115 Score = 30.8 bits (68), Expect(3) = 1e-07 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 26.6 bits (57), Expect(3) = 1e-07 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F DR SIAYN REFG +++ Sbjct: 115 FGDRFSIAYNLDREFGPILKE 135 >ref|XP_002877968.1| ATVAMP727 [Arabidopsis lyrata subsp. lyrata] gi|297323806|gb|EFH54227.1| ATVAMP727 [Arabidopsis lyrata subsp. lyrata] Length = 240 Score = 44.7 bits (104), Expect(3) = 1e-07 Identities = 37/81 (45%), Positives = 44/81 (54%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------- 358 LQKLP++ + CDG FL D VF VVADES G S+PFVFLE+VK Sbjct: 36 LQKLPTNSSKYTYSCDGHTFNFLV-DNGFVFLVVADESTGRSVPFVFLERVKEDFKKRYE 94 Query: 357 -GVMVRTL*PIVD-DEDDDFF 301 + P+ D DEDDD F Sbjct: 95 ASIKNDERHPLADEDEDDDLF 115 Score = 30.8 bits (68), Expect(3) = 1e-07 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 26.6 bits (57), Expect(3) = 1e-07 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F DR SIAYN REFG +++ Sbjct: 115 FGDRFSIAYNLDREFGPILKE 135 >ref|XP_002269134.1| PREDICTED: vesicle-associated membrane protein 727 isoform 1 [Vitis vinifera] gi|296086578|emb|CBI32213.3| unnamed protein product [Vitis vinifera] Length = 239 Score = 43.5 bits (101), Expect(3) = 1e-07 Identities = 36/78 (46%), Positives = 44/78 (56%), Gaps = 17/78 (21%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------G 355 LQKLPS+ + CDG FL D VF VVADES G PFVFLE+VK G Sbjct: 36 LQKLPSNSSKYTYSCDGHTFNFLI-DSGFVFLVVADESAGRGAPFVFLERVKDDFKQRYG 94 Query: 354 VMVRT--L*PIVDDEDDD 307 +R+ P+ D++DDD Sbjct: 95 GSIRSDGPHPLADEDDDD 112 Score = 30.8 bits (68), Expect(3) = 1e-07 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 156 AQITEVKGIMMDNIEKV 172 Score = 27.7 bits (60), Expect(3) = 1e-07 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F+DR SIAYN REFG +++ Sbjct: 116 FEDRFSIAYNLDREFGPKLKE 136 >ref|NP_190998.1| vesicle-associated membrane protein 727 [Arabidopsis thaliana] gi|145332835|ref|NP_001078283.1| vesicle-associated membrane protein 727 [Arabidopsis thaliana] gi|27805764|sp|Q9M376.1|VA727_ARATH RecName: Full=Vesicle-associated membrane protein 727; Short=AtVAMP727 gi|6822076|emb|CAB71004.1| synaptobrevin-like protein [Arabidopsis thaliana] gi|44681344|gb|AAS47612.1| At3g54300 [Arabidopsis thaliana] gi|45773850|gb|AAS76729.1| At3g54300 [Arabidopsis thaliana] gi|110738122|dbj|BAF00993.1| synaptobrevin -like protein [Arabidopsis thaliana] gi|332645689|gb|AEE79210.1| vesicle-associated membrane protein 727 [Arabidopsis thaliana] gi|332645690|gb|AEE79211.1| vesicle-associated membrane protein 727 [Arabidopsis thaliana] Length = 240 Score = 44.7 bits (104), Expect(3) = 1e-07 Identities = 37/81 (45%), Positives = 44/81 (54%), Gaps = 18/81 (22%) Frame = -3 Query: 489 LQKLPSSPPPF---CDG----FLC*DKN*VF-VVADESMGGSIPFVFLEKVK-------- 358 LQKLP++ + CDG FL D VF VVADES G S+PFVFLE+VK Sbjct: 36 LQKLPTNSSKYTYSCDGHTFNFLV-DNGFVFLVVADESTGRSVPFVFLERVKEDFKKRYE 94 Query: 357 -GVMVRTL*PIVD-DEDDDFF 301 + P+ D DEDDD F Sbjct: 95 ASIKNDERHPLADEDEDDDLF 115 Score = 30.8 bits (68), Expect(3) = 1e-07 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 205 AQITKDKGIMLDNIEKV 155 AQIT+ KGIM+DNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 26.2 bits (56), Expect(3) = 1e-07 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 302 FKDRLSIAYNPVREFGCAMRK 240 F DR S+AYN REFG +++ Sbjct: 115 FGDRFSVAYNLDREFGPILKE 135