BLASTX nr result
ID: Rehmannia25_contig00016216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00016216 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ04833.1| hypothetical protein PRUPE_ppa003994mg [Prunus pe... 59 9e-07 ref|XP_006465714.1| PREDICTED: 6-phosphofructokinase 3-like [Cit... 58 1e-06 ref|XP_006426847.1| hypothetical protein CICLE_v10025255mg [Citr... 58 1e-06 gb|EXB24699.1| 6-phosphofructokinase 3 [Morus notabilis] 57 2e-06 gb|ESW09253.1| hypothetical protein PHAVU_009G112400g [Phaseolus... 57 2e-06 gb|EOY29820.1| Phosphofructokinase 3 isoform 3 [Theobroma cacao] 57 2e-06 gb|EOY29819.1| Phosphofructokinase 3 isoform 2, partial [Theobro... 57 2e-06 gb|EOY29818.1| Phosphofructokinase 3 isoform 1 [Theobroma cacao] 57 2e-06 ref|XP_006280374.1| hypothetical protein CARUB_v10026301mg [Caps... 57 2e-06 dbj|BAB09881.1| pyrophosphate-dependent phosphofructo-1-kinase-l... 57 2e-06 ref|NP_568842.1| 6-phosphofructokinase 7 [Arabidopsis thaliana] ... 57 2e-06 gb|EXB60275.1| 6-phosphofructokinase 3 [Morus notabilis] 57 3e-06 ref|XP_006413209.1| hypothetical protein EUTSA_v10025029mg [Eutr... 57 3e-06 ref|XP_006401301.1| hypothetical protein EUTSA_v10013372mg [Eutr... 57 3e-06 gb|EOY26965.1| 6-phosphofructokinase 3 [Theobroma cacao] 57 3e-06 ref|XP_006285534.1| hypothetical protein CARUB_v10006975mg [Caps... 57 3e-06 ref|XP_003564328.1| PREDICTED: 6-phosphofructokinase 3-like [Bra... 57 3e-06 gb|AEQ94164.1| 6-phosphofructokinase [Elaeis guineensis] 57 3e-06 ref|XP_002867573.1| phosphofructokinase family protein [Arabidop... 57 3e-06 ref|XP_002864472.1| phosphofructokinase family protein [Arabidop... 57 3e-06 >gb|EMJ04833.1| hypothetical protein PRUPE_ppa003994mg [Prunus persica] Length = 536 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 227 KEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 + A P ++VYFESDDVHACIVTCGGLCPGL Sbjct: 123 RRAGPRQKVYFESDDVHACIVTCGGLCPGL 152 >ref|XP_006465714.1| PREDICTED: 6-phosphofructokinase 3-like [Citrus sinensis] Length = 535 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 215 PTEQVYFESDDVHACIVTCGGLCPGL 138 P E+VYFESDDVHACIVTCGGLCPGL Sbjct: 135 PREKVYFESDDVHACIVTCGGLCPGL 160 >ref|XP_006426847.1| hypothetical protein CICLE_v10025255mg [Citrus clementina] gi|557528837|gb|ESR40087.1| hypothetical protein CICLE_v10025255mg [Citrus clementina] Length = 576 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 215 PTEQVYFESDDVHACIVTCGGLCPGL 138 P E+VYFESDDVHACIVTCGGLCPGL Sbjct: 135 PREKVYFESDDVHACIVTCGGLCPGL 160 >gb|EXB24699.1| 6-phosphofructokinase 3 [Morus notabilis] Length = 485 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 236 VILKEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 V + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 68 VHFRRAGPRQKVYFESDEVHACIVTCGGLCPGL 100 >gb|ESW09253.1| hypothetical protein PHAVU_009G112400g [Phaseolus vulgaris] Length = 210 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 236 VILKEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 V + A P ++VYF+SDDVHACIVTCGGLCPGL Sbjct: 75 VHFRRAGPRQKVYFKSDDVHACIVTCGGLCPGL 107 >gb|EOY29820.1| Phosphofructokinase 3 isoform 3 [Theobroma cacao] Length = 479 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 236 VILKEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 V + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 74 VHFRRAGPRQRVYFESDEVHACIVTCGGLCPGL 106 >gb|EOY29819.1| Phosphofructokinase 3 isoform 2, partial [Theobroma cacao] Length = 359 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 236 VILKEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 V + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 74 VHFRRAGPRQRVYFESDEVHACIVTCGGLCPGL 106 >gb|EOY29818.1| Phosphofructokinase 3 isoform 1 [Theobroma cacao] Length = 490 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 236 VILKEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 V + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 74 VHFRRAGPRQRVYFESDEVHACIVTCGGLCPGL 106 >ref|XP_006280374.1| hypothetical protein CARUB_v10026301mg [Capsella rubella] gi|482549078|gb|EOA13272.1| hypothetical protein CARUB_v10026301mg [Capsella rubella] Length = 487 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 236 VILKEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 V + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 74 VHFRRAGPRQKVYFESDEVHACIVTCGGLCPGL 106 >dbj|BAB09881.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis thaliana] Length = 488 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 236 VILKEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 V + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 74 VHFRRAGPRQKVYFESDEVHACIVTCGGLCPGL 106 >ref|NP_568842.1| 6-phosphofructokinase 7 [Arabidopsis thaliana] gi|75168960|sp|Q9C5J7.1|K6PF7_ARATH RecName: Full=6-phosphofructokinase 7; AltName: Full=Phosphofructokinase 7; AltName: Full=Phosphohexokinase 7 gi|13430590|gb|AAK25917.1|AF360207_1 putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis thaliana] gi|14532862|gb|AAK64113.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis thaliana] gi|332009407|gb|AED96790.1| 6-phosphofructokinase 7 [Arabidopsis thaliana] Length = 485 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 236 VILKEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 V + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 74 VHFRRAGPRQKVYFESDEVHACIVTCGGLCPGL 106 >gb|EXB60275.1| 6-phosphofructokinase 3 [Morus notabilis] Length = 495 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 227 KEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 77 RRAGPRQKVYFESDEVHACIVTCGGLCPGL 106 >ref|XP_006413209.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum] gi|557114379|gb|ESQ54662.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum] Length = 489 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 227 KEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 77 RRAGPRQKVYFESDEVHACIVTCGGLCPGL 106 >ref|XP_006401301.1| hypothetical protein EUTSA_v10013372mg [Eutrema salsugineum] gi|557102391|gb|ESQ42754.1| hypothetical protein EUTSA_v10013372mg [Eutrema salsugineum] Length = 490 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 227 KEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 77 RRAGPRQKVYFESDEVHACIVTCGGLCPGL 106 >gb|EOY26965.1| 6-phosphofructokinase 3 [Theobroma cacao] Length = 534 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 227 KEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 129 RRAGPRQKVYFESDEVHACIVTCGGLCPGL 158 >ref|XP_006285534.1| hypothetical protein CARUB_v10006975mg [Capsella rubella] gi|482554239|gb|EOA18432.1| hypothetical protein CARUB_v10006975mg [Capsella rubella] Length = 489 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 227 KEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 77 RRAGPRQKVYFESDEVHACIVTCGGLCPGL 106 >ref|XP_003564328.1| PREDICTED: 6-phosphofructokinase 3-like [Brachypodium distachyon] Length = 551 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 227 KEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 136 RRAGPRQRVYFESDEVHACIVTCGGLCPGL 165 >gb|AEQ94164.1| 6-phosphofructokinase [Elaeis guineensis] Length = 280 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 227 KEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 19 RRAGPRQRVYFESDEVHACIVTCGGLCPGL 48 >ref|XP_002867573.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297313409|gb|EFH43832.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 478 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 227 KEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 77 RRAGPRQKVYFESDEVHACIVTCGGLCPGL 106 >ref|XP_002864472.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297310307|gb|EFH40731.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 485 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 227 KEAPPTEQVYFESDDVHACIVTCGGLCPGL 138 + A P ++VYFESD+VHACIVTCGGLCPGL Sbjct: 77 RRAGPRQKVYFESDEVHACIVTCGGLCPGL 106