BLASTX nr result
ID: Rehmannia25_contig00015968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00015968 (618 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus... 150 4e-34 gb|EXB36262.1| 50S ribosomal protein L19 [Morus notabilis] 149 8e-34 ref|XP_002511309.1| 50S ribosomal protein L19, putative [Ricinus... 149 8e-34 ref|XP_004299148.1| PREDICTED: 50S ribosomal protein L19, chloro... 145 1e-32 ref|XP_004160907.1| PREDICTED: 50S ribosomal protein L19, chloro... 145 1e-32 ref|XP_004139446.1| PREDICTED: 50S ribosomal protein L19, chloro... 145 1e-32 ref|XP_006399688.1| hypothetical protein EUTSA_v10014577mg [Eutr... 144 1e-32 gb|ESW18616.1| hypothetical protein PHAVU_006G055700g [Phaseolus... 144 3e-32 gb|EPS71409.1| hypothetical protein M569_03350, partial [Genlise... 144 3e-32 gb|AFO66523.1| putative ribosomal protein L19 family protein [Br... 143 3e-32 gb|AFO66496.1| putative 50S ribosomal protein L19 [Brassica napus] 143 3e-32 emb|CBI14940.3| unnamed protein product [Vitis vinifera] 143 3e-32 ref|XP_002277262.1| PREDICTED: uncharacterized protein LOC100255... 143 3e-32 ref|XP_006288575.1| hypothetical protein CARUB_v10001866mg [Caps... 142 7e-32 ref|XP_002871497.1| ribosomal protein L19 family protein [Arabid... 141 1e-31 ref|NP_196736.1| ribosomal protein L19 family protein [Arabidops... 141 1e-31 ref|NP_192900.1| ribosomal protein L19 [Arabidopsis thaliana] gi... 141 1e-31 gb|EOY22266.1| Ribosomal protein L19 family protein isoform 2 [T... 141 2e-31 gb|EOY22265.1| Ribosomal protein L19 family protein isoform 1 [T... 141 2e-31 ref|XP_006348561.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 140 2e-31 >ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus communis] gi|223540999|gb|EEF42557.1| 50S ribosomal protein L19, putative [Ricinus communis] Length = 248 Score = 150 bits (378), Expect = 4e-34 Identities = 74/79 (93%), Positives = 78/79 (98%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS++KGIVIARRNAGLNTTFR+RRLVAGVG+ESL PLYSPNIKEIKVLDKKK Sbjct: 170 EVPENKRRVSIVKGIVIARRNAGLNTTFRLRRLVAGVGVESLFPLYSPNIKEIKVLDKKK 229 Query: 401 VRRAKLYYLRDKMNALKKQ 345 VRRAKLYYLRDKMNALKKQ Sbjct: 230 VRRAKLYYLRDKMNALKKQ 248 >gb|EXB36262.1| 50S ribosomal protein L19 [Morus notabilis] Length = 187 Score = 149 bits (375), Expect = 8e-34 Identities = 74/79 (93%), Positives = 78/79 (98%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS++KGIVIARRNAGLNTTFRIRRLVAGVG+ESL PLYSPNIKEIKVLDKKK Sbjct: 109 EVPENKRRVSIMKGIVIARRNAGLNTTFRIRRLVAGVGVESLFPLYSPNIKEIKVLDKKK 168 Query: 401 VRRAKLYYLRDKMNALKKQ 345 VRRAKLYYLRDKMNALK+Q Sbjct: 169 VRRAKLYYLRDKMNALKRQ 187 >ref|XP_002511309.1| 50S ribosomal protein L19, putative [Ricinus communis] gi|223550424|gb|EEF51911.1| 50S ribosomal protein L19, putative [Ricinus communis] Length = 190 Score = 149 bits (375), Expect = 8e-34 Identities = 73/79 (92%), Positives = 78/79 (98%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS++KGIVIARRNAGLNTTFR+RRLVAGVG+ESL PLYSPNIKEI+VLDKKK Sbjct: 112 EVPENKRRVSIVKGIVIARRNAGLNTTFRLRRLVAGVGVESLFPLYSPNIKEIRVLDKKK 171 Query: 401 VRRAKLYYLRDKMNALKKQ 345 VRRAKLYYLRDKMNALKKQ Sbjct: 172 VRRAKLYYLRDKMNALKKQ 190 >ref|XP_004299148.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 242 Score = 145 bits (365), Expect = 1e-32 Identities = 71/78 (91%), Positives = 77/78 (98%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVP+NKRRVSV+KGIVIARRNAGLN+TFR+RRLVAGVG+ESL PLYSPNIKEIK+LDKKK Sbjct: 164 EVPDNKRRVSVLKGIVIARRNAGLNSTFRLRRLVAGVGVESLFPLYSPNIKEIKILDKKK 223 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDKMNALKK Sbjct: 224 VRRAKLYYLRDKMNALKK 241 >ref|XP_004160907.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] Length = 189 Score = 145 bits (365), Expect = 1e-32 Identities = 72/79 (91%), Positives = 77/79 (97%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRR+S +KGIVIARRNAGLN+TFRIRR+VAGVGIESL PLYSPNIKEIKVL+KKK Sbjct: 111 EVPENKRRISTLKGIVIARRNAGLNSTFRIRRVVAGVGIESLFPLYSPNIKEIKVLEKKK 170 Query: 401 VRRAKLYYLRDKMNALKKQ 345 VRRAKLYYLRDKMNALKKQ Sbjct: 171 VRRAKLYYLRDKMNALKKQ 189 >ref|XP_004139446.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] Length = 269 Score = 145 bits (365), Expect = 1e-32 Identities = 72/79 (91%), Positives = 77/79 (97%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRR+S +KGIVIARRNAGLN+TFRIRR+VAGVGIESL PLYSPNIKEIKVL+KKK Sbjct: 191 EVPENKRRISTLKGIVIARRNAGLNSTFRIRRVVAGVGIESLFPLYSPNIKEIKVLEKKK 250 Query: 401 VRRAKLYYLRDKMNALKKQ 345 VRRAKLYYLRDKMNALKKQ Sbjct: 251 VRRAKLYYLRDKMNALKKQ 269 >ref|XP_006399688.1| hypothetical protein EUTSA_v10014577mg [Eutrema salsugineum] gi|557100778|gb|ESQ41141.1| hypothetical protein EUTSA_v10014577mg [Eutrema salsugineum] Length = 230 Score = 144 bits (364), Expect = 1e-32 Identities = 70/78 (89%), Positives = 77/78 (98%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS++KGIVIARRNAGLN+TFRIRRLVAGVG+ES+ PLYSPN++EIKVLDKKK Sbjct: 152 EVPENKRRVSIVKGIVIARRNAGLNSTFRIRRLVAGVGVESMFPLYSPNLREIKVLDKKK 211 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDKMNALKK Sbjct: 212 VRRAKLYYLRDKMNALKK 229 >gb|ESW18616.1| hypothetical protein PHAVU_006G055700g [Phaseolus vulgaris] Length = 231 Score = 144 bits (362), Expect = 3e-32 Identities = 72/77 (93%), Positives = 75/77 (97%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRR+S+IKGIVIARRNAGLNTTFRIRR VAGVGIESL PLYSPNIKEIKVLDKKK Sbjct: 154 EVPENKRRISIIKGIVIARRNAGLNTTFRIRRQVAGVGIESLFPLYSPNIKEIKVLDKKK 213 Query: 401 VRRAKLYYLRDKMNALK 351 VRRAKLYYLRD+MNALK Sbjct: 214 VRRAKLYYLRDRMNALK 230 >gb|EPS71409.1| hypothetical protein M569_03350, partial [Genlisea aurea] Length = 167 Score = 144 bits (362), Expect = 3e-32 Identities = 72/78 (92%), Positives = 76/78 (97%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS+IKG+VIA RNAGLN+TFRIRRLVAGVGIESL PLYSPNIKEIKVL+KKK Sbjct: 90 EVPENKRRVSIIKGVVIAMRNAGLNSTFRIRRLVAGVGIESLFPLYSPNIKEIKVLEKKK 149 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDKMNALKK Sbjct: 150 VRRAKLYYLRDKMNALKK 167 >gb|AFO66523.1| putative ribosomal protein L19 family protein [Brassica napus] Length = 127 Score = 143 bits (361), Expect = 3e-32 Identities = 69/78 (88%), Positives = 77/78 (98%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS++KGIVIARRNAGLN+TFRIRRLVAGVG+ES+ PLYSPN++EIKVLDKK+ Sbjct: 49 EVPENKRRVSIVKGIVIARRNAGLNSTFRIRRLVAGVGVESMFPLYSPNLREIKVLDKKR 108 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDKMNALKK Sbjct: 109 VRRAKLYYLRDKMNALKK 126 >gb|AFO66496.1| putative 50S ribosomal protein L19 [Brassica napus] Length = 260 Score = 143 bits (361), Expect = 3e-32 Identities = 69/78 (88%), Positives = 77/78 (98%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS++KGIVIARRNAGLN+TFRIRRLVAGVG+ES+ PLYSPN++EIKVLDKK+ Sbjct: 182 EVPENKRRVSIVKGIVIARRNAGLNSTFRIRRLVAGVGVESMFPLYSPNLREIKVLDKKR 241 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDKMNALKK Sbjct: 242 VRRAKLYYLRDKMNALKK 259 >emb|CBI14940.3| unnamed protein product [Vitis vinifera] Length = 270 Score = 143 bits (361), Expect = 3e-32 Identities = 71/78 (91%), Positives = 76/78 (97%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRR SV+KGIVIARRNAGLNTTFR+RRLVAGVG+ESL PLYSP+IKEIKVLDKKK Sbjct: 193 EVPENKRRTSVLKGIVIARRNAGLNTTFRLRRLVAGVGVESLFPLYSPSIKEIKVLDKKK 252 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDKMNAL+K Sbjct: 253 VRRAKLYYLRDKMNALRK 270 >ref|XP_002277262.1| PREDICTED: uncharacterized protein LOC100255272 [Vitis vinifera] Length = 243 Score = 143 bits (361), Expect = 3e-32 Identities = 71/78 (91%), Positives = 76/78 (97%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRR SV+KGIVIARRNAGLNTTFR+RRLVAGVG+ESL PLYSP+IKEIKVLDKKK Sbjct: 166 EVPENKRRTSVLKGIVIARRNAGLNTTFRLRRLVAGVGVESLFPLYSPSIKEIKVLDKKK 225 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDKMNAL+K Sbjct: 226 VRRAKLYYLRDKMNALRK 243 >ref|XP_006288575.1| hypothetical protein CARUB_v10001866mg [Capsella rubella] gi|482557281|gb|EOA21473.1| hypothetical protein CARUB_v10001866mg [Capsella rubella] Length = 234 Score = 142 bits (358), Expect = 7e-32 Identities = 69/78 (88%), Positives = 76/78 (97%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVSV+KG+VIARRNAGLN+TFRIRRLVAGVG+ES+ PLYSPN++EIKVLDKKK Sbjct: 156 EVPENKRRVSVVKGVVIARRNAGLNSTFRIRRLVAGVGVESMFPLYSPNLREIKVLDKKK 215 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDK NALKK Sbjct: 216 VRRAKLYYLRDKTNALKK 233 >ref|XP_002871497.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] gi|297317334|gb|EFH47756.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] Length = 225 Score = 141 bits (356), Expect = 1e-31 Identities = 67/78 (85%), Positives = 77/78 (98%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS++KG+VIARRNAGLN+TFRIRRLVAGVG+ES+ PLYSPN++EIKV+DKKK Sbjct: 147 EVPENKRRVSIVKGVVIARRNAGLNSTFRIRRLVAGVGVESMFPLYSPNLREIKVVDKKK 206 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDK+NALKK Sbjct: 207 VRRAKLYYLRDKVNALKK 224 >ref|NP_196736.1| ribosomal protein L19 family protein [Arabidopsis thaliana] gi|14030717|gb|AAK53033.1|AF375449_1 AT5g11750/T22P22_140 [Arabidopsis thaliana] gi|7573389|emb|CAB87693.1| putative protein [Arabidopsis thaliana] gi|16974529|gb|AAL31174.1| AT5g11750/T22P22_140 [Arabidopsis thaliana] gi|332004334|gb|AED91717.1| ribosomal protein L19 family protein [Arabidopsis thaliana] Length = 229 Score = 141 bits (356), Expect = 1e-31 Identities = 67/78 (85%), Positives = 77/78 (98%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS++KG+VIARRNAGLN+TFRIRRLVAGVG+ES+ PLYSPN++EIKV+DKKK Sbjct: 151 EVPENKRRVSIVKGVVIARRNAGLNSTFRIRRLVAGVGVESMFPLYSPNLREIKVVDKKK 210 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDK+NALKK Sbjct: 211 VRRAKLYYLRDKVNALKK 228 >ref|NP_192900.1| ribosomal protein L19 [Arabidopsis thaliana] gi|4539454|emb|CAB39934.1| putative protein [Arabidopsis thaliana] gi|7267863|emb|CAB78206.1| putative protein [Arabidopsis thaliana] gi|45752768|gb|AAS76282.1| At4g11630 [Arabidopsis thaliana] gi|62320252|dbj|BAD94523.1| putative protein [Arabidopsis thaliana] gi|332657631|gb|AEE83031.1| ribosomal protein L19 [Arabidopsis thaliana] Length = 225 Score = 141 bits (356), Expect = 1e-31 Identities = 67/78 (85%), Positives = 77/78 (98%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS++KG+VIARRNAGLN+TFRIRRLVAGVG+ES+ PLYSPN++EIKV+DKKK Sbjct: 147 EVPENKRRVSIVKGVVIARRNAGLNSTFRIRRLVAGVGVESMFPLYSPNLREIKVVDKKK 206 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDK+NALKK Sbjct: 207 VRRAKLYYLRDKVNALKK 224 >gb|EOY22266.1| Ribosomal protein L19 family protein isoform 2 [Theobroma cacao] Length = 240 Score = 141 bits (355), Expect = 2e-31 Identities = 70/77 (90%), Positives = 74/77 (96%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS IKGIVIARRNAGLNTTFR+RR+VAGVG+ESL PLYSPNIKEIKVLDKK Sbjct: 164 EVPENKRRVSTIKGIVIARRNAGLNTTFRLRRMVAGVGVESLFPLYSPNIKEIKVLDKKT 223 Query: 401 VRRAKLYYLRDKMNALK 351 VRRAKLYYLRDKMNAL+ Sbjct: 224 VRRAKLYYLRDKMNALR 240 >gb|EOY22265.1| Ribosomal protein L19 family protein isoform 1 [Theobroma cacao] Length = 247 Score = 141 bits (355), Expect = 2e-31 Identities = 70/77 (90%), Positives = 74/77 (96%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS IKGIVIARRNAGLNTTFR+RR+VAGVG+ESL PLYSPNIKEIKVLDKK Sbjct: 171 EVPENKRRVSTIKGIVIARRNAGLNTTFRLRRMVAGVGVESLFPLYSPNIKEIKVLDKKT 230 Query: 401 VRRAKLYYLRDKMNALK 351 VRRAKLYYLRDKMNAL+ Sbjct: 231 VRRAKLYYLRDKMNALR 247 >ref|XP_006348561.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Solanum tuberosum] Length = 257 Score = 140 bits (354), Expect = 2e-31 Identities = 70/78 (89%), Positives = 75/78 (96%) Frame = -2 Query: 581 EVPENKRRVSVIKGIVIARRNAGLNTTFRIRRLVAGVGIESLLPLYSPNIKEIKVLDKKK 402 EVPENKRRVS IKGIVIARRNAGLNTTFR+RRLVAGVG+E+L LYSPN+KEIKVLDKK+ Sbjct: 179 EVPENKRRVSTIKGIVIARRNAGLNTTFRLRRLVAGVGVENLFHLYSPNLKEIKVLDKKR 238 Query: 401 VRRAKLYYLRDKMNALKK 348 VRRAKLYYLRDKMNALKK Sbjct: 239 VRRAKLYYLRDKMNALKK 256