BLASTX nr result
ID: Rehmannia25_contig00015738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00015738 (305 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS57781.1| hypothetical protein M569_17036, partial [Genlise... 47 8e-06 >gb|EPS57781.1| hypothetical protein M569_17036, partial [Genlisea aurea] Length = 381 Score = 46.6 bits (109), Expect(2) = 8e-06 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 5/52 (9%) Frame = +2 Query: 2 VAEMGIEKPLEPFL--YMT*FLLRIK---LDGWTFLIRGIAQIMHIVPVHVC 142 +AEMGIEK L+P + L+ + LD W LI+G+AQ++H+VPVH C Sbjct: 49 LAEMGIEKQLDPPKNGLLVPELIPVAYELLDNWKLLIKGVAQLLHVVPVHAC 100 Score = 28.5 bits (62), Expect(2) = 8e-06 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 250 CSGIYVSQMGPDIQDCRG 303 CS I+V+Q G +IQDC G Sbjct: 103 CSEIHVAQAGHEIQDCHG 120