BLASTX nr result
ID: Rehmannia25_contig00015251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00015251 (638 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67918.1| hypothetical protein M569_06855, partial [Genlise... 80 7e-13 ref|XP_006346418.1| PREDICTED: B3 domain-containing protein Os01... 75 2e-11 ref|XP_006346417.1| PREDICTED: B3 domain-containing protein Os01... 75 2e-11 ref|XP_006346416.1| PREDICTED: B3 domain-containing protein Os01... 75 2e-11 ref|XP_004230782.1| PREDICTED: B3 domain-containing protein At5g... 75 2e-11 gb|EOX98226.1| AP2/B3-like transcriptional factor family protein... 64 5e-08 ref|XP_004240808.1| PREDICTED: B3 domain-containing protein Os01... 62 1e-07 ref|XP_002313111.1| hypothetical protein POPTR_0009s10610g [Popu... 62 1e-07 gb|EMJ00371.1| hypothetical protein PRUPE_ppa021390mg [Prunus pe... 62 1e-07 gb|EMJ01456.1| hypothetical protein PRUPE_ppa015021mg [Prunus pe... 62 2e-07 ref|XP_006423042.1| hypothetical protein CICLE_v10030084mg, part... 61 2e-07 ref|XP_004294824.1| PREDICTED: B3 domain-containing protein Os01... 61 2e-07 ref|XP_006573914.1| PREDICTED: B3 domain-containing protein Os01... 60 4e-07 ref|XP_003516780.1| PREDICTED: B3 domain-containing protein Os01... 60 4e-07 ref|XP_004140693.1| PREDICTED: B3 domain-containing protein Os01... 60 7e-07 ref|XP_002324684.1| hypothetical protein POPTR_0018s13750g [Popu... 59 1e-06 ref|XP_002282068.2| PREDICTED: B3 domain-containing protein Os01... 59 2e-06 emb|CBI32429.3| unnamed protein product [Vitis vinifera] 59 2e-06 gb|EPS67917.1| hypothetical protein M569_06854, partial [Genlise... 58 3e-06 ref|XP_002330290.1| predicted protein [Populus trichocarpa] 58 3e-06 >gb|EPS67918.1| hypothetical protein M569_06855, partial [Genlisea aurea] Length = 139 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = -2 Query: 637 SYLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKVRPILSSK 497 ++LLGR+GLSAGWRGFSI+HRLLKGDILIFHLI+PCK KV + ++K Sbjct: 82 TFLLGRYGLSAGWRGFSISHRLLKGDILIFHLIQPCKFKVHIVRANK 128 >ref|XP_006346418.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform X3 [Solanum tuberosum] Length = 267 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 637 SYLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKV 518 SYLL R+GLSAGWRGFSI+HRLLKGD+LIF LIEPCK+KV Sbjct: 104 SYLLERNGLSAGWRGFSISHRLLKGDLLIFRLIEPCKMKV 143 >ref|XP_006346417.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform X2 [Solanum tuberosum] Length = 309 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 637 SYLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKV 518 SYLL R+GLSAGWRGFSI+HRLLKGD+LIF LIEPCK+KV Sbjct: 171 SYLLERNGLSAGWRGFSISHRLLKGDLLIFRLIEPCKMKV 210 >ref|XP_006346416.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform X1 [Solanum tuberosum] Length = 334 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 637 SYLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKV 518 SYLL R+GLSAGWRGFSI+HRLLKGD+LIF LIEPCK+KV Sbjct: 171 SYLLERNGLSAGWRGFSISHRLLKGDLLIFRLIEPCKMKV 210 >ref|XP_004230782.1| PREDICTED: B3 domain-containing protein At5g42700-like [Solanum lycopersicum] Length = 336 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 637 SYLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKV 518 SYLL R+GLSAGWRGFSI+HRLLKGD+LIF LIEPCK+KV Sbjct: 173 SYLLERNGLSAGWRGFSISHRLLKGDLLIFRLIEPCKMKV 212 >gb|EOX98226.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma cacao] Length = 465 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKV 518 YL+ + GLS GWRGFSIAH+LL+GD+ +FHLI+P KLKV Sbjct: 134 YLVEKTGLSGGWRGFSIAHKLLEGDVCVFHLIKPSKLKV 172 >ref|XP_004240808.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Solanum lycopersicum] Length = 445 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKV 518 YL+ ++GLS GWRGFSIAH LL+GD+L+F LI+P K KV Sbjct: 131 YLIDKNGLSGGWRGFSIAHNLLEGDVLVFQLIQPSKFKV 169 >ref|XP_002313111.1| hypothetical protein POPTR_0009s10610g [Populus trichocarpa] gi|222849519|gb|EEE87066.1| hypothetical protein POPTR_0009s10610g [Populus trichocarpa] Length = 439 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKV 518 YL + GLSAGWRGFSI H++++GD+LIFHL+EP K KV Sbjct: 121 YLARKVGLSAGWRGFSIDHKIMEGDVLIFHLVEPAKFKV 159 >gb|EMJ00371.1| hypothetical protein PRUPE_ppa021390mg [Prunus persica] Length = 366 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKVRPILSS 500 YL+ + GLS GWRGFSIAH+LL+GDI+IFH++ P K+KV + S+ Sbjct: 94 YLVEKGGLSGGWRGFSIAHKLLQGDIVIFHVVAPFKIKVYIVRSN 138 >gb|EMJ01456.1| hypothetical protein PRUPE_ppa015021mg [Prunus persica] Length = 359 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKVRPILSS 500 YL + GLS GWRGFSIAH+LL+GD+++FHL+ P K KV + S+ Sbjct: 91 YLADKVGLSGGWRGFSIAHKLLEGDVIVFHLVTPSKFKVYIVRSN 135 >ref|XP_006423042.1| hypothetical protein CICLE_v10030084mg, partial [Citrus clementina] gi|557524976|gb|ESR36282.1| hypothetical protein CICLE_v10030084mg, partial [Citrus clementina] Length = 354 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKV 518 YL+ + GLSAGWRGFSIAH+L++GD L+FHL+ P K KV Sbjct: 86 YLVEKIGLSAGWRGFSIAHKLVEGDALVFHLVTPSKFKV 124 >ref|XP_004294824.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Fragaria vesca subsp. vesca] Length = 107 Score = 61.2 bits (147), Expect = 2e-07 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKVR 515 YL+G+ GL+AGWRGFSI+H+LL GD+++FH + P K K++ Sbjct: 65 YLVGKGGLNAGWRGFSISHKLLAGDVVVFHRVTPSKFKIK 104 >ref|XP_006573914.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform X2 [Glycine max] Length = 342 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKVRPILSSK 497 YL + GLSAGWRGFSIAH LL+ D+LIFHL++P K +V I S + Sbjct: 79 YLAQKAGLSAGWRGFSIAHNLLEMDVLIFHLVQPSKFRVYIIRSQE 124 >ref|XP_003516780.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform X1 [Glycine max] Length = 361 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKVRPILSSK 497 YL + GLSAGWRGFSIAH LL+ D+LIFHL++P K +V I S + Sbjct: 79 YLAQKAGLSAGWRGFSIAHNLLEMDVLIFHLVQPSKFRVYIIRSQE 124 >ref|XP_004140693.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Cucumis sativus] gi|449519168|ref|XP_004166607.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Cucumis sativus] Length = 220 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKVRPILSS 500 YL + GLSAGWRGFSIAH+LL+GD+++FHL+ P K V + S+ Sbjct: 127 YLSDKTGLSAGWRGFSIAHKLLQGDVIVFHLVMPNKFMVYIVRSN 171 >ref|XP_002324684.1| hypothetical protein POPTR_0018s13750g [Populus trichocarpa] gi|222866118|gb|EEF03249.1| hypothetical protein POPTR_0018s13750g [Populus trichocarpa] Length = 404 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKV 518 YL + GLS GWRGFSI H L++GD+L+FHL++P K KV Sbjct: 65 YLAHKSGLSGGWRGFSIDHNLVEGDVLVFHLVKPTKFKV 103 >ref|XP_002282068.2| PREDICTED: B3 domain-containing protein Os01g0234100-like [Vitis vinifera] Length = 463 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKV 518 +L+G+ GLS GWRGFSIAH LL+GD+L+F L++P K V Sbjct: 147 FLVGKTGLSGGWRGFSIAHNLLEGDVLVFGLVQPTKFMV 185 >emb|CBI32429.3| unnamed protein product [Vitis vinifera] Length = 363 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKV 518 +L+G+ GLS GWRGFSIAH LL+GD+L+F L++P K V Sbjct: 89 FLVGKTGLSGGWRGFSIAHNLLEGDVLVFGLVQPTKFMV 127 >gb|EPS67917.1| hypothetical protein M569_06854, partial [Genlisea aurea] Length = 339 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/50 (48%), Positives = 35/50 (70%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKVRPILSSKMPYN 485 Y ++ +S GWRGFS AH+L++GD L+FHL+EPC+ KV + + K N Sbjct: 65 YSFRKNRISGGWRGFSNAHKLMEGDSLVFHLLEPCRFKVYIVRACKASEN 114 >ref|XP_002330290.1| predicted protein [Populus trichocarpa] Length = 193 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = -2 Query: 634 YLLGRHGLSAGWRGFSIAHRLLKGDILIFHLIEPCKLKVRPILSSKM 494 Y+ R GLS GWRGFSI HRLL+ D L+F LIEP KLK+ + ++++ Sbjct: 65 YIAERTGLSGGWRGFSIEHRLLEQDTLVFQLIEPDKLKIYIVRANRL 111