BLASTX nr result
ID: Rehmannia25_contig00015076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00015076 (482 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC32759.1| hypothetical protein L484_019872 [Morus notabilis] 68 1e-09 gb|EOY29131.1| ChaC family protein-like [Theobroma cacao] 68 1e-09 ref|XP_004291271.1| PREDICTED: cation transport regulator-like p... 68 1e-09 ref|XP_002330830.1| predicted protein [Populus trichocarpa] gi|5... 68 1e-09 gb|ABK95363.1| unknown [Populus trichocarpa] 68 1e-09 ref|XP_003588617.1| Cation transport regulator-like protein [Med... 68 1e-09 ref|XP_002332121.1| predicted protein [Populus trichocarpa] gi|5... 68 1e-09 gb|ABK96295.1| unknown [Populus trichocarpa x Populus deltoides] 68 1e-09 ref|XP_006483635.1| PREDICTED: cation transport regulator-like p... 67 2e-09 gb|EMJ25126.1| hypothetical protein PRUPE_ppa011048mg [Prunus pe... 67 2e-09 gb|AFK43603.1| unknown [Lotus japonicus] 67 2e-09 ref|XP_004501211.1| PREDICTED: cation transport regulator-like p... 67 3e-09 ref|XP_004164100.1| PREDICTED: cation transport regulator-like p... 67 3e-09 ref|XP_003522674.1| PREDICTED: cation transport regulator-like p... 67 3e-09 gb|ESW09137.1| hypothetical protein PHAVU_009G103300g [Phaseolus... 66 5e-09 ref|XP_006357035.1| PREDICTED: cation transport regulator-like p... 65 7e-09 ref|XP_006342471.1| PREDICTED: cation transport regulator-like p... 65 7e-09 ref|XP_006450090.1| hypothetical protein CICLE_v10009681mg [Citr... 65 7e-09 ref|XP_006450089.1| hypothetical protein CICLE_v10009681mg [Citr... 65 7e-09 ref|XP_004253067.1| PREDICTED: cation transport regulator-like p... 65 7e-09 >gb|EXC32759.1| hypothetical protein L484_019872 [Morus notabilis] Length = 226 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGFE DEKVIGFIKDY Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGFIKDY 30 >gb|EOY29131.1| ChaC family protein-like [Theobroma cacao] Length = 325 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGFE DEKVIGFIKDY Sbjct: 101 MVFWVFGYGSLVWNPGFEYDEKVIGFIKDY 130 >ref|XP_004291271.1| PREDICTED: cation transport regulator-like protein 2-like [Fragaria vesca subsp. vesca] Length = 224 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGFE DEKVIGFIKDY Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGFIKDY 30 >ref|XP_002330830.1| predicted protein [Populus trichocarpa] gi|566178786|ref|XP_006382203.1| ChaC-like family protein [Populus trichocarpa] gi|550337358|gb|ERP60000.1| ChaC-like family protein [Populus trichocarpa] Length = 223 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGFE DEKVIGFIKDY Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGFIKDY 30 >gb|ABK95363.1| unknown [Populus trichocarpa] Length = 223 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGFE DEKVIGFIKDY Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGFIKDY 30 >ref|XP_003588617.1| Cation transport regulator-like protein [Medicago truncatula] gi|355477665|gb|AES58868.1| Cation transport regulator-like protein [Medicago truncatula] Length = 206 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGFE DEKV+GFIKDY Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVVGFIKDY 30 >ref|XP_002332121.1| predicted protein [Populus trichocarpa] gi|566214136|ref|XP_006371827.1| ChaC-like family protein [Populus trichocarpa] gi|550318000|gb|ERP49624.1| ChaC-like family protein [Populus trichocarpa] Length = 223 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFW+FGYGSLVWNPGFE DEKVIGFIKDY Sbjct: 1 MVFWIFGYGSLVWNPGFEYDEKVIGFIKDY 30 >gb|ABK96295.1| unknown [Populus trichocarpa x Populus deltoides] Length = 223 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFW+FGYGSLVWNPGFE DEKVIGFIKDY Sbjct: 1 MVFWIFGYGSLVWNPGFEYDEKVIGFIKDY 30 >ref|XP_006483635.1| PREDICTED: cation transport regulator-like protein 2-like isoform X1 [Citrus sinensis] gi|568860247|ref|XP_006483636.1| PREDICTED: cation transport regulator-like protein 2-like isoform X2 [Citrus sinensis] gi|568860249|ref|XP_006483637.1| PREDICTED: cation transport regulator-like protein 2-like isoform X3 [Citrus sinensis] Length = 225 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGFE DEK++GFIKDY Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKILGFIKDY 30 >gb|EMJ25126.1| hypothetical protein PRUPE_ppa011048mg [Prunus persica] Length = 225 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGFE DEKVIG+IKDY Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGYIKDY 30 >gb|AFK43603.1| unknown [Lotus japonicus] Length = 224 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGFE DEKVIG+IKDY Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKVIGYIKDY 30 >ref|XP_004501211.1| PREDICTED: cation transport regulator-like protein 2-like [Cicer arietinum] Length = 224 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGF+ DEK+IGFIKDY Sbjct: 1 MVFWVFGYGSLVWNPGFDYDEKIIGFIKDY 30 >ref|XP_004164100.1| PREDICTED: cation transport regulator-like protein 2-like [Cucumis sativus] Length = 224 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGFE DEK+IG+IKDY Sbjct: 1 MVFWVFGYGSLVWNPGFEFDEKIIGYIKDY 30 >ref|XP_003522674.1| PREDICTED: cation transport regulator-like protein 2-like [Glycine max] Length = 224 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGF+ DEK+IGFIKDY Sbjct: 1 MVFWVFGYGSLVWNPGFDYDEKIIGFIKDY 30 >gb|ESW09137.1| hypothetical protein PHAVU_009G103300g [Phaseolus vulgaris] Length = 220 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGF+ DEK+IGFIKDY Sbjct: 1 MVFWVFGYGSLVWNPGFDYDEKMIGFIKDY 30 >ref|XP_006357035.1| PREDICTED: cation transport regulator-like protein 2-like [Solanum tuberosum] Length = 227 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFW+FGYGSLVWNPGFE DEK+IG+IKDY Sbjct: 1 MVFWIFGYGSLVWNPGFEYDEKMIGYIKDY 30 >ref|XP_006342471.1| PREDICTED: cation transport regulator-like protein 2-like isoform X1 [Solanum tuberosum] gi|565351050|ref|XP_006342472.1| PREDICTED: cation transport regulator-like protein 2-like isoform X2 [Solanum tuberosum] Length = 225 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFW+FGYGSLVWNPGFE DEK+IG+IKDY Sbjct: 1 MVFWIFGYGSLVWNPGFEYDEKLIGYIKDY 30 >ref|XP_006450090.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|567916170|ref|XP_006450091.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|567916176|ref|XP_006450094.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553316|gb|ESR63330.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553317|gb|ESR63331.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553320|gb|ESR63334.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] Length = 225 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGF+ DEK++GFIKDY Sbjct: 1 MVFWVFGYGSLVWNPGFKYDEKILGFIKDY 30 >ref|XP_006450089.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|567916172|ref|XP_006450092.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|567916174|ref|XP_006450093.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553315|gb|ESR63329.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553318|gb|ESR63332.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] gi|557553319|gb|ESR63333.1| hypothetical protein CICLE_v10009681mg [Citrus clementina] Length = 175 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFWVFGYGSLVWNPGF+ DEK++GFIKDY Sbjct: 1 MVFWVFGYGSLVWNPGFKYDEKILGFIKDY 30 >ref|XP_004253067.1| PREDICTED: cation transport regulator-like protein 2-like [Solanum lycopersicum] Length = 225 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 391 MVFWVFGYGSLVWNPGFEVDEKVIGFIKDY 480 MVFW+FGYGSLVWNPGFE DEK+IG+IKDY Sbjct: 1 MVFWIFGYGSLVWNPGFEYDEKLIGYIKDY 30