BLASTX nr result
ID: Rehmannia25_contig00014961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00014961 (424 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS58932.1| hypothetical protein M569_15880, partial [Genlise... 92 5e-17 ref|XP_004235371.1| PREDICTED: type I inositol 1,4,5-trisphospha... 89 6e-16 ref|XP_006347361.1| PREDICTED: type I inositol 1,4,5-trisphospha... 87 2e-15 ref|XP_006363998.1| PREDICTED: type I inositol 1,4,5-trisphospha... 86 4e-15 ref|XP_002317714.2| hypothetical protein POPTR_0012s03840g, part... 86 5e-15 ref|XP_004241466.1| PREDICTED: type I inositol 1,4,5-trisphospha... 86 5e-15 ref|XP_006583483.1| PREDICTED: type I inositol 1,4,5-trisphospha... 84 3e-14 ref|XP_006583481.1| PREDICTED: type I inositol 1,4,5-trisphospha... 84 3e-14 ref|XP_006583479.1| PREDICTED: type I inositol 1,4,5-trisphospha... 84 3e-14 gb|EMJ10409.1| hypothetical protein PRUPE_ppa006664mg [Prunus pe... 84 3e-14 ref|XP_006374232.1| hypothetical protein POPTR_0015s05260g [Popu... 83 3e-14 ref|XP_002329707.1| predicted protein [Populus trichocarpa] 83 3e-14 gb|ESW24630.1| hypothetical protein PHAVU_004G146600g [Phaseolus... 82 1e-13 ref|XP_006448080.1| hypothetical protein CICLE_v10015366mg [Citr... 80 2e-13 ref|XP_004498104.1| PREDICTED: type I inositol 1,4,5-trisphospha... 80 2e-13 ref|XP_003619924.1| Inositol 1 4 5-trisphosphate 5-phosphatase [... 80 2e-13 ref|XP_002521915.1| type I inositol polyphosphate 5-phosphatase,... 79 5e-13 gb|ESW25026.1| hypothetical protein PHAVU_003G001800g [Phaseolus... 79 6e-13 gb|ESW30771.1| hypothetical protein PHAVU_002G181200g [Phaseolus... 79 8e-13 ref|XP_003532688.1| PREDICTED: type I inositol 1,4,5-trisphospha... 78 1e-12 >gb|EPS58932.1| hypothetical protein M569_15880, partial [Genlisea aurea] Length = 261 Score = 92.4 bits (228), Expect = 5e-17 Identities = 43/58 (74%), Positives = 48/58 (82%) Frame = -2 Query: 174 YT*QQGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPLQH 1 Y +GSVSI F L+ETSFCFVC+HLASGGK+GDERQRN DA HIL RTLFPAE + H Sbjct: 147 YLGNKGSVSIRFYLYETSFCFVCTHLASGGKKGDERQRNTDATHILTRTLFPAESVHH 204 >ref|XP_004235371.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2-like [Solanum lycopersicum] Length = 383 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/53 (73%), Positives = 47/53 (88%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPLQ 4 +GSVS+ FCLHETSFCFVCSHLASGGKEGD+R+RNA+A IL+RT F ++P Q Sbjct: 181 KGSVSVRFCLHETSFCFVCSHLASGGKEGDKRERNANASQILSRTQFSSDPFQ 233 >ref|XP_006347361.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2-like [Solanum tuberosum] Length = 364 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/58 (70%), Positives = 46/58 (79%) Frame = -2 Query: 174 YT*QQGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPLQH 1 Y +GSVS+ F LHETSFCFVCSHLASGGKEGDERQRNADA IL+RT F + Q+ Sbjct: 167 YLGNKGSVSVRFWLHETSFCFVCSHLASGGKEGDERQRNADASQILSRTRFSCDSFQY 224 >ref|XP_006363998.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2-like [Solanum tuberosum] Length = 387 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/53 (69%), Positives = 46/53 (86%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPLQ 4 +GSVS+ FCLHETSFCFVCSHLASGGKEGD+++RNA+ IL+RT F ++P Q Sbjct: 185 KGSVSVRFCLHETSFCFVCSHLASGGKEGDKKERNANVSQILSRTQFSSDPFQ 237 >ref|XP_002317714.2| hypothetical protein POPTR_0012s03840g, partial [Populus trichocarpa] gi|550326329|gb|EEE95934.2| hypothetical protein POPTR_0012s03840g, partial [Populus trichocarpa] Length = 304 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPLQH 1 +GSVS+ FCLHETS CFVCSHLASGGKEGDE+ RNADA IL+RT F PL++ Sbjct: 119 KGSVSVRFCLHETSLCFVCSHLASGGKEGDEKSRNADATEILSRTRFSRGPLRN 172 >ref|XP_004241466.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2-like [Solanum lycopersicum] Length = 364 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/58 (68%), Positives = 46/58 (79%) Frame = -2 Query: 174 YT*QQGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPLQH 1 Y +GSVS+ F LHETSFCFVCSHLASGGKEGDE+QRNADA IL+RT F + Q+ Sbjct: 167 YLGNKGSVSVRFWLHETSFCFVCSHLASGGKEGDEKQRNADATQILSRTRFSCDSFQY 224 >ref|XP_006583483.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2 isoform X5 [Glycine max] Length = 324 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPL 7 +GS+SI F LHETSFCF+CSHLASGGKE D R RN +A HIL+RT+FP+ PL Sbjct: 131 KGSISIRFYLHETSFCFICSHLASGGKEVDRRHRNVNAAHILSRTIFPSGPL 182 >ref|XP_006583481.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2 isoform X3 [Glycine max] gi|571465817|ref|XP_006583482.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2 isoform X4 [Glycine max] Length = 383 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPL 7 +GS+SI F LHETSFCF+CSHLASGGKE D R RN +A HIL+RT+FP+ PL Sbjct: 190 KGSISIRFYLHETSFCFICSHLASGGKEVDRRHRNVNAAHILSRTIFPSGPL 241 >ref|XP_006583479.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2 isoform X1 [Glycine max] gi|571465813|ref|XP_006583480.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2 isoform X2 [Glycine max] Length = 394 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPL 7 +GS+SI F LHETSFCF+CSHLASGGKE D R RN +A HIL+RT+FP+ PL Sbjct: 201 KGSISIRFYLHETSFCFICSHLASGGKEVDRRHRNVNAAHILSRTIFPSGPL 252 >gb|EMJ10409.1| hypothetical protein PRUPE_ppa006664mg [Prunus persica] Length = 401 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEP 10 +GSVS+ F LHETSFCFVCSHLASGGKEGD+R+RNA+A IL+RT FP P Sbjct: 173 KGSVSVRFWLHETSFCFVCSHLASGGKEGDQRRRNANAAEILSRTTFPPGP 223 >ref|XP_006374232.1| hypothetical protein POPTR_0015s05260g [Populus trichocarpa] gi|550321989|gb|ERP52029.1| hypothetical protein POPTR_0015s05260g [Populus trichocarpa] Length = 444 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPLQH 1 +GSVS+ FCLHETSFCFVCSHLASGGKEGDE+ RNA+A IL+ T F PL++ Sbjct: 214 KGSVSVRFCLHETSFCFVCSHLASGGKEGDEKNRNANAIEILSSTRFSRGPLRN 267 >ref|XP_002329707.1| predicted protein [Populus trichocarpa] Length = 444 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPLQH 1 +GSVS+ FCLHETSFCFVCSHLASGGKEGDE+ RNA+A IL+ T F PL++ Sbjct: 214 KGSVSVRFCLHETSFCFVCSHLASGGKEGDEKNRNANAIEILSSTRFSRGPLRN 267 >gb|ESW24630.1| hypothetical protein PHAVU_004G146600g [Phaseolus vulgaris] gi|561025946|gb|ESW24631.1| hypothetical protein PHAVU_004G146600g [Phaseolus vulgaris] Length = 395 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/56 (69%), Positives = 44/56 (78%) Frame = -2 Query: 174 YT*QQGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPL 7 Y +GSVSI F LHETSFCFVCSHLASGGKE D RQRN +A IL+RT+F + PL Sbjct: 200 YLGNKGSVSIRFYLHETSFCFVCSHLASGGKEADRRQRNVNATDILSRTIFTSGPL 255 >ref|XP_006448080.1| hypothetical protein CICLE_v10015366mg [Citrus clementina] gi|568878672|ref|XP_006492310.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2-like [Citrus sinensis] gi|557550691|gb|ESR61320.1| hypothetical protein CICLE_v10015366mg [Citrus clementina] Length = 420 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPL 7 +GSVS+ F L+ETSFCFVCSHLASGGKEGDE+ RN+D IL+RT FP PL Sbjct: 196 KGSVSVRFQLYETSFCFVCSHLASGGKEGDEKYRNSDVAEILSRTSFPRGPL 247 >ref|XP_004498104.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2-like [Cicer arietinum] Length = 446 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPL 7 +GSVS+ F LHETSFCFVCSHLASGGKEGDE+ RN++ I +RT FP PL Sbjct: 218 KGSVSVRFLLHETSFCFVCSHLASGGKEGDEKHRNSNVAEIFSRTSFPRGPL 269 >ref|XP_003619924.1| Inositol 1 4 5-trisphosphate 5-phosphatase [Medicago truncatula] gi|355494939|gb|AES76142.1| Inositol 1 4 5-trisphosphate 5-phosphatase [Medicago truncatula] Length = 390 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPL 7 +GS+SI F LHETSFCF+CSHLASGGKE D+RQRNA+A IL++T FP PL Sbjct: 196 KGSISIRFFLHETSFCFICSHLASGGKEEDKRQRNANAADILSQTNFPVGPL 247 >ref|XP_002521915.1| type I inositol polyphosphate 5-phosphatase, putative [Ricinus communis] gi|223538953|gb|EEF40551.1| type I inositol polyphosphate 5-phosphatase, putative [Ricinus communis] Length = 426 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEP 10 +GSVS+ F LHETSFCF+CSHLASGG+EGDE+ RN+D IL RT FP P Sbjct: 218 KGSVSVRFQLHETSFCFICSHLASGGREGDEKHRNSDVAEILLRTSFPRGP 268 >gb|ESW25026.1| hypothetical protein PHAVU_003G001800g [Phaseolus vulgaris] Length = 444 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPL 7 +GSVS+ F LHETSFCFVC HLASGG+EGDER RN++ I +RT FP PL Sbjct: 214 KGSVSVRFVLHETSFCFVCGHLASGGREGDERHRNSNVAEIFSRTSFPKGPL 265 >gb|ESW30771.1| hypothetical protein PHAVU_002G181200g [Phaseolus vulgaris] Length = 430 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPL 7 +GSVS+ F LHETSFCFVCSHLASGG+EGDE+ RN++ I +RT FP PL Sbjct: 199 KGSVSVRFQLHETSFCFVCSHLASGGREGDEKHRNSNVTEIFSRTSFPRGPL 250 >ref|XP_003532688.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2-like [Glycine max] Length = 436 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -2 Query: 162 QGSVSISFCLHETSFCFVCSHLASGGKEGDERQRNADAEHILARTLFPAEPL 7 +GS+S+ F LHETSFCFVCSHLASGG+EGDE+ RN++ I +RT FP PL Sbjct: 205 KGSISVRFQLHETSFCFVCSHLASGGREGDEKHRNSNVAEIFSRTSFPRGPL 256