BLASTX nr result
ID: Rehmannia25_contig00014781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00014781 (375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGU37277.1| jasmonate ZIM-domain protein 7b [Nicotiana tabacum] 64 3e-08 ref|NP_001275246.1| uncharacterized protein LOC102589610 [Solanu... 64 3e-08 ref|XP_004235771.1| PREDICTED: protein TIFY 6B-like [Solanum lyc... 62 6e-08 dbj|BAD04852.2| hypothetical protein [Nicotiana benthamiana] 62 6e-08 >gb|AGU37277.1| jasmonate ZIM-domain protein 7b [Nicotiana tabacum] Length = 393 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 2/54 (3%) Frame = +3 Query: 219 MERDFMGLS--VKQETSDETIDAAPVRSLPMQWSFSKKGSAPPHLLSFHGVQEE 374 MERDFMGL+ VKQE ++E ID AP+RS MQWSFS S P LSF G QE+ Sbjct: 1 MERDFMGLTHHVKQEVTEEPIDPAPLRSSAMQWSFSNNISTHPQYLSFKGAQED 54 >ref|NP_001275246.1| uncharacterized protein LOC102589610 [Solanum tuberosum] gi|39652276|dbj|BAD04851.1| hypothetical protein [Solanum tuberosum] Length = 390 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = +3 Query: 219 MERDFMGLSVKQETSDETIDAAPVRSLPMQWSFSKKGSAPPHLLSFHGVQEE 374 MERDFMGL+VKQE +E ID AP+RS MQWSFS +A P LSF E+ Sbjct: 1 MERDFMGLTVKQEVLEEPIDPAPLRSSAMQWSFSNNVTAHPQYLSFKSAPED 52 >ref|XP_004235771.1| PREDICTED: protein TIFY 6B-like [Solanum lycopersicum] Length = 390 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = +3 Query: 219 MERDFMGLSVKQETSDETIDAAPVRSLPMQWSFSKKGSAPPHLLSFHGVQEE 374 MERDFMGL+VKQE +E ID AP+RS MQWSF+ +A P LSF E+ Sbjct: 1 MERDFMGLTVKQEVLEEPIDPAPLRSSAMQWSFTNNVTAHPQYLSFKSAPED 52 >dbj|BAD04852.2| hypothetical protein [Nicotiana benthamiana] Length = 380 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/54 (61%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = +3 Query: 219 MERDFMGLS--VKQETSDETIDAAPVRSLPMQWSFSKKGSAPPHLLSFHGVQEE 374 MERDFMGL+ VKQE +E ID AP+RS MQWSFS S P LSF G QE+ Sbjct: 1 MERDFMGLTHHVKQEVIEEPIDPAPLRSSAMQWSFSNNISTHPRYLSFKGAQED 54