BLASTX nr result
ID: Rehmannia25_contig00014727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00014727 (325 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76025.1| hypothetical protein VITISV_041931 [Vitis vinifera] 57 3e-06 gb|EXB36077.1| hypothetical protein L484_018235 [Morus notabilis] 55 7e-06 >emb|CAN76025.1| hypothetical protein VITISV_041931 [Vitis vinifera] Length = 237 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 8/69 (11%) Frame = -2 Query: 318 FQLLTHALNKNCLFLICNGLLVFLAKTSGFIRPPPS--DNSNN--IKRIGN----IYGLQ 163 FQLLTH +N+NC+FL+CNG+LVFLA+ SG I S D+++ IK+ G+ + + Sbjct: 58 FQLLTHTINRNCIFLLCNGILVFLARNSGLIISSSSGFDHADEYLIKKTGDRLPLLLDKE 117 Query: 162 MALEAKEPP 136 E EPP Sbjct: 118 ATTETTEPP 126 >gb|EXB36077.1| hypothetical protein L484_018235 [Morus notabilis] Length = 240 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 318 FQLLTHALNKNCLFLICNGLLVFLAKTSGFIRPPPSDNSN 199 +QL THA++KNC+FLICNGLLVFL K SG R S +S+ Sbjct: 39 YQLFTHAIDKNCIFLICNGLLVFLTKYSGLARSFSSSSSH 78