BLASTX nr result
ID: Rehmannia25_contig00014623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00014623 (404 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ23668.1| hypothetical protein PRUPE_ppa003520mg [Prunus pe... 56 6e-06 >gb|EMJ23668.1| hypothetical protein PRUPE_ppa003520mg [Prunus persica] Length = 568 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 YYKSKKGRKTEKEVQEAEQAVLETPDVDAD 92 YYKSKKGRKTEKEVQEAEQA+LETP + D Sbjct: 534 YYKSKKGRKTEKEVQEAEQAILETPSAEVD 563