BLASTX nr result
ID: Rehmannia25_contig00014326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00014326 (393 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298616.2| hypothetical protein POPTR_0001s33960g [Popu... 89 6e-16 gb|EOY02766.1| Cupredoxin superfamily protein [Theobroma cacao] 89 8e-16 gb|AFK46705.1| unknown [Lotus japonicus] 86 5e-15 ref|XP_002509536.1| Blue copper protein precursor, putative [Ric... 86 5e-15 gb|EMJ17467.1| hypothetical protein PRUPE_ppa017323mg [Prunus pe... 86 7e-15 ref|XP_006338690.1| PREDICTED: blue copper protein-like [Solanum... 85 1e-14 ref|XP_004231787.1| PREDICTED: blue copper protein-like [Solanum... 85 1e-14 ref|XP_006447099.1| hypothetical protein CICLE_v10016947mg [Citr... 84 2e-14 ref|XP_002262831.1| PREDICTED: blue copper protein [Vitis vinife... 83 3e-14 ref|NP_001237874.1| uncharacterized protein LOC100305865 precurs... 83 4e-14 gb|ESW33740.1| hypothetical protein PHAVU_001G095100g [Phaseolus... 82 1e-13 ref|XP_006848436.1| hypothetical protein AMTR_s00013p00238100 [A... 82 1e-13 gb|ESW23526.1| hypothetical protein PHAVU_004G054700g [Phaseolus... 81 1e-13 ref|XP_004489604.1| PREDICTED: blue copper protein-like [Cicer a... 81 2e-13 gb|ACR77748.1| plastocyanin-like domain-containing protein [Astr... 80 3e-13 gb|ABK26728.1| unknown [Picea sitchensis] 79 6e-13 ref|XP_004303985.1| PREDICTED: blue copper protein-like [Fragari... 79 8e-13 ref|NP_001237236.1| uncharacterized protein LOC100306337 precurs... 79 8e-13 gb|EXC31334.1| Blue copper protein [Morus notabilis] 77 2e-12 ref|XP_006395473.1| hypothetical protein EUTSA_v10005008mg [Eutr... 77 2e-12 >ref|XP_002298616.2| hypothetical protein POPTR_0001s33960g [Populus trichocarpa] gi|550348805|gb|EEE83421.2| hypothetical protein POPTR_0001s33960g [Populus trichocarpa] Length = 168 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/51 (76%), Positives = 47/51 (92%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K+++AA+H VGGSQGW+ESTDF+SWAS Q FKVGD+L FKYT+GLHSVVEL Sbjct: 17 KEAMAAQHVVGGSQGWEESTDFSSWASGQKFKVGDQLVFKYTSGLHSVVEL 67 >gb|EOY02766.1| Cupredoxin superfamily protein [Theobroma cacao] Length = 206 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 KQ+ AA+H VGGSQGWDES D NSWAS QTFKVGD+L FKY++GLHSVVEL Sbjct: 61 KQASAAQHVVGGSQGWDESVDLNSWASGQTFKVGDQLVFKYSSGLHSVVEL 111 >gb|AFK46705.1| unknown [Lotus japonicus] Length = 162 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K++LA +H VGGSQGWD+STDFNSW S +TF VGD+L FKY++GLHSVVEL Sbjct: 18 KEALAEQHVVGGSQGWDQSTDFNSWVSGKTFNVGDQLVFKYSSGLHSVVEL 68 >ref|XP_002509536.1| Blue copper protein precursor, putative [Ricinus communis] gi|223549435|gb|EEF50923.1| Blue copper protein precursor, putative [Ricinus communis] Length = 166 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K+ +AA+H VGGSQGWDES DF+SW S++ FKVGD+L FKYT+GLHSVVEL Sbjct: 17 KEGMAAQHVVGGSQGWDESADFSSWTSSKKFKVGDQLAFKYTSGLHSVVEL 67 >gb|EMJ17467.1| hypothetical protein PRUPE_ppa017323mg [Prunus persica] Length = 172 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K+ AA+ VGGSQGWDESTDFNSWASAQ FKVGD+L FKY++GLHS+VEL Sbjct: 19 KKGFAAQLTVGGSQGWDESTDFNSWASAQKFKVGDQLVFKYSSGLHSLVEL 69 >ref|XP_006338690.1| PREDICTED: blue copper protein-like [Solanum tuberosum] Length = 170 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K ++AA+H VGGSQGWDES DF SWAS QTFKVGD L F+Y GLHSVVEL Sbjct: 20 KNAMAAQHVVGGSQGWDESADFKSWASGQTFKVGDTLVFRYNPGLHSVVEL 70 >ref|XP_004231787.1| PREDICTED: blue copper protein-like [Solanum lycopersicum] Length = 170 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K ++AA+H VGGSQGWDES DF SWAS QTFKVGD L F+Y GLHSVVEL Sbjct: 20 KNAMAAQHVVGGSQGWDESADFKSWASGQTFKVGDTLVFRYNPGLHSVVEL 70 >ref|XP_006447099.1| hypothetical protein CICLE_v10016947mg [Citrus clementina] gi|568831574|ref|XP_006470037.1| PREDICTED: blue copper protein-like [Citrus sinensis] gi|557549710|gb|ESR60339.1| hypothetical protein CICLE_v10016947mg [Citrus clementina] Length = 172 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K++ AA+H VGGSQGW ES D NSWAS QTFKVGD++ FKYT GLHSVVEL Sbjct: 21 KEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVEL 71 >ref|XP_002262831.1| PREDICTED: blue copper protein [Vitis vinifera] gi|296090231|emb|CBI40050.3| unnamed protein product [Vitis vinifera] Length = 176 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = +2 Query: 242 QSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 ++LA +H VGGSQGWDES+D++ WAS QTF+VGD+L FKYT GLHSVVEL Sbjct: 20 KALATQHVVGGSQGWDESSDYSKWASGQTFEVGDQLVFKYTPGLHSVVEL 69 >ref|NP_001237874.1| uncharacterized protein LOC100305865 precursor [Glycine max] gi|255626823|gb|ACU13756.1| unknown [Glycine max] Length = 162 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K+++A +H VGGSQGWDESTDFNSW S QTFKVGD+L FKY++ LHSVVEL Sbjct: 18 KETMAEQHVVGGSQGWDESTDFNSWVSGQTFKVGDQLVFKYSS-LHSVVEL 67 >gb|ESW33740.1| hypothetical protein PHAVU_001G095100g [Phaseolus vulgaris] Length = 166 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 242 QSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 +++A +H VGGSQGWD ST+FNSW S QTF VGD+L FKY++GLHSVVEL Sbjct: 19 EAMAEQHVVGGSQGWDASTNFNSWVSGQTFNVGDQLVFKYSSGLHSVVEL 68 >ref|XP_006848436.1| hypothetical protein AMTR_s00013p00238100 [Amborella trichopoda] gi|548851742|gb|ERN10017.1| hypothetical protein AMTR_s00013p00238100 [Amborella trichopoda] Length = 173 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +2 Query: 245 SLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 + AKH VGGSQGW+ STD +SWASAQTF+VGD+L FKYT GLHSVVEL Sbjct: 23 AFGAKHEVGGSQGWELSTDLDSWASAQTFRVGDQLVFKYTKGLHSVVEL 71 >gb|ESW23526.1| hypothetical protein PHAVU_004G054700g [Phaseolus vulgaris] Length = 186 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K+ AA+H VGGSQGWD+STDFNSW S QTFKVGD+L FKY++ LHSVVEL Sbjct: 18 KEVFAAQHVVGGSQGWDQSTDFNSWTSGQTFKVGDKLVFKYSS-LHSVVEL 67 >ref|XP_004489604.1| PREDICTED: blue copper protein-like [Cicer arietinum] Length = 174 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K++LA +H VGGSQGWD+STDF+SW S QTFKVGD+L FKY++ LHSVVEL Sbjct: 18 KEALATQHVVGGSQGWDQSTDFDSWTSGQTFKVGDQLVFKYSS-LHSVVEL 67 >gb|ACR77748.1| plastocyanin-like domain-containing protein [Astragalus sinicus] Length = 191 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K+ LA KH VGGSQGWD STDFNSW S +TFKVGD+L FKY++ LHSVVEL Sbjct: 18 KEVLATKHVVGGSQGWDASTDFNSWISGKTFKVGDQLVFKYSS-LHSVVEL 67 >gb|ABK26728.1| unknown [Picea sitchensis] Length = 184 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +2 Query: 248 LAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 +A ++ VGGSQGWD STDFN+W S +TFKVGD L FKYT GLHSVVEL Sbjct: 34 MAVQYPVGGSQGWDLSTDFNTWESGKTFKVGDTLSFKYTTGLHSVVEL 81 >ref|XP_004303985.1| PREDICTED: blue copper protein-like [Fragaria vesca subsp. vesca] Length = 184 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K+ LAA+H VGGSQGW++STD NSWAS+Q FKVGD+L FKY++ +HSVVEL Sbjct: 19 KKGLAAQHVVGGSQGWEQSTDLNSWASSQKFKVGDQLVFKYSS-MHSVVEL 68 >ref|NP_001237236.1| uncharacterized protein LOC100306337 precursor [Glycine max] gi|255628239|gb|ACU14464.1| unknown [Glycine max] Length = 190 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K++ AA+H VGGSQGWD+STDF SW S QTFKVGD+L FKY++ HSVVEL Sbjct: 18 KEAFAAQHVVGGSQGWDQSTDFKSWTSGQTFKVGDKLVFKYSS-FHSVVEL 67 >gb|EXC31334.1| Blue copper protein [Morus notabilis] Length = 179 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 KQ+ +A+H VGGSQGWD STDFNSW S +TFKVGD L FKY+A LHSV EL Sbjct: 19 KQAQSAQHVVGGSQGWDASTDFNSWVSDKTFKVGDHLVFKYSA-LHSVAEL 68 >ref|XP_006395473.1| hypothetical protein EUTSA_v10005008mg [Eutrema salsugineum] gi|557092112|gb|ESQ32759.1| hypothetical protein EUTSA_v10005008mg [Eutrema salsugineum] Length = 175 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/51 (68%), Positives = 45/51 (88%) Frame = +2 Query: 239 KQSLAAKHAVGGSQGWDESTDFNSWASAQTFKVGDELEFKYTAGLHSVVEL 391 K +LAA+H +GGSQGW++S DF+SW+S Q+FKVGD+L FKY +GLHSVVEL Sbjct: 19 KTTLAAQHVIGGSQGWEQSVDFDSWSSDQSFKVGDQLVFKY-SGLHSVVEL 68