BLASTX nr result
ID: Rehmannia25_contig00013936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00013936 (352 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS91798.1| Ulp1-like peptidase [Cucumis melo] gi|51477401|gb... 56 4e-06 >gb|AAS91798.1| Ulp1-like peptidase [Cucumis melo] gi|51477401|gb|AAU04774.1| Ulp1 peptidase-like [Cucumis melo] Length = 423 Score = 56.2 bits (134), Expect = 4e-06 Identities = 33/112 (29%), Positives = 57/112 (50%), Gaps = 8/112 (7%) Frame = -1 Query: 313 PWSSLDHVVFIHNI-GSHWIVVRIALKDCTIWIYDSNIHKLPXXXXXX-------PFARI 158 PW+S+D+V N+ G+HW+++ + L C + ++DS LP P ++ Sbjct: 280 PWASVDYVYSPFNVHGNHWVLLCLDLVSCQVKVWDS----LPSLTTAEEMTNILLPIRQL 335 Query: 157 IPVLLRQTGFYQERPELTSRENTWTVKVVGPSKNYEQHDSHSCGPFALRRVE 2 +P LL TGF+ R ++ + W V +V P Q ++ CG FA++ E Sbjct: 336 VPKLLDSTGFFDRRGRSSTYKEPWPVVIVDPIP--LQRNNCDCGVFAIKYFE 385