BLASTX nr result
ID: Rehmannia25_contig00013833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00013833 (586 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006478364.1| PREDICTED: probable carboxylesterase 18-like... 57 5e-06 >ref|XP_006478364.1| PREDICTED: probable carboxylesterase 18-like [Citrus sinensis] Length = 322 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +3 Query: 3 KEVELIEYPNAFHSFYAFPEVAEFQMLMDNVRDFVRKK 116 KE LIEYPNAFHSFY FPEV E ++++ VRDF++K+ Sbjct: 282 KEAYLIEYPNAFHSFYTFPEVLESSLMINEVRDFMQKQ 319