BLASTX nr result
ID: Rehmannia25_contig00013684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00013684 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849552.1| hypothetical protein AMTR_s00024p00174810 [A... 58 1e-06 >ref|XP_006849552.1| hypothetical protein AMTR_s00024p00174810 [Amborella trichopoda] gi|548853127|gb|ERN11133.1| hypothetical protein AMTR_s00024p00174810 [Amborella trichopoda] Length = 402 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/71 (38%), Positives = 44/71 (61%) Frame = +3 Query: 108 MESQKDLMKPLMKGESKNEGIDENMKWMSRMTSDFLERLPEKVKCGVDPEDLFNLHLSAA 287 ME + KPL+ G ++ + + ++ + DF+ +LPEK K G+DPE F++ +S Sbjct: 1 MEGGEGAKKPLLGGSARKPRLYHRIS-LNTLRGDFISKLPEKAKSGLDPEKPFHIDVSKI 59 Query: 288 KGLLQGEKDYY 320 KGL +GEK+YY Sbjct: 60 KGLSEGEKEYY 70