BLASTX nr result
ID: Rehmannia25_contig00012769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00012769 (411 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77450.1| hypothetical protein VITISV_016971 [Vitis vinifera] 59 7e-07 >emb|CAN77450.1| hypothetical protein VITISV_016971 [Vitis vinifera] Length = 652 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +1 Query: 283 LPGTMIVLSWNCRGLGNPRAIPVLCDLVRAHKPDILILFETL 408 LP MI +SWNCRGLGNPR + LC++ ++ KPD + L ETL Sbjct: 303 LPTAMIGISWNCRGLGNPRTVLALCEINKSRKPDFIFLIETL 344