BLASTX nr result
ID: Rehmannia25_contig00012486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00012486 (546 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70719.1| hypothetical protein M569_04042, partial [Genlise... 76 5e-12 >gb|EPS70719.1| hypothetical protein M569_04042, partial [Genlisea aurea] Length = 373 Score = 76.3 bits (186), Expect = 5e-12 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = +2 Query: 305 RSYGMWPPSQQFRNPNSNPGAMKPPPSGFNKSLAPRNNWKG--KKVNKPNDKRRTEQQKS 478 R YG+WP F+NPN + G +K P +GF KSL PRNNWKG KK + P DKRR +QQKS Sbjct: 47 RGYGVWPAPPHFQNPNRSIGVLKQPLTGFRKSLGPRNNWKGKNKKSSNPIDKRRIDQQKS 106