BLASTX nr result
ID: Rehmannia25_contig00012256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00012256 (571 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlise... 80 5e-13 ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|AB... 62 8e-08 >gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlisea aurea] Length = 56 Score = 79.7 bits (195), Expect = 5e-13 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -2 Query: 198 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLF*AVTRNQLRSIEIAQ 64 RDVAQLGSAFVLGTKCHGFKSCHPYLLLL AV++N++RSIEIA+ Sbjct: 1 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLKRAVSQNKVRSIEIAR 45 >ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|ABP35351.1| ORF66a [Pinus koraiensis] Length = 66 Score = 62.4 bits (150), Expect = 8e-08 Identities = 30/59 (50%), Positives = 39/59 (66%) Frame = -2 Query: 198 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLF*AVTRNQLRSIEIAQNHSLL*NYRIYVFI 22 RDVAQLGS FVLGTKC FKSCHPYL LLF + I I + H ++ +Y++ ++ Sbjct: 4 RDVAQLGSVFVLGTKCRRFKSCHPYLSLLFYGKKGTKDHLISIRREHQIIESYQMRKYL 62