BLASTX nr result
ID: Rehmannia25_contig00011487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00011487 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC24376.1| cathepsin B-like cysteine proteinase [Arabidopsis... 65 1e-08 ref|NP_563647.1| putative cathepsin B-like cysteine protease [Ar... 65 1e-08 dbj|BAD94873.1| cathepsin B-like cysteine proteinase like protei... 65 1e-08 ref|XP_006288020.1| hypothetical protein CARUB_v10001253mg [Caps... 64 2e-08 ref|NP_849281.1| putative cathepsin B-like cysteine protease [Ar... 64 2e-08 ref|NP_567215.1| putative cathepsin B-like cysteine protease [Ar... 64 2e-08 gb|ABF47216.1| cathepsin B [Nicotiana benthamiana] 64 2e-08 emb|CAA57522.1| cathepsin B-like cysteine proteinase [Nicotiana ... 64 2e-08 ref|NP_563648.1| putative cathepsin B-like cysteine protease [Ar... 64 2e-08 ref|XP_002889395.1| hypothetical protein ARALYDRAFT_887368 [Arab... 64 2e-08 dbj|BAH20325.1| AT1G02305 [Arabidopsis thaliana] 64 2e-08 ref|XP_006305170.1| hypothetical protein CARUB_v10009537mg [Caps... 64 3e-08 gb|EXB94879.1| Cathepsin B [Morus notabilis] 63 4e-08 ref|XP_004978395.1| PREDICTED: cathepsin B-like [Setaria italica] 63 5e-08 gb|AAF04727.1|AF101239_1 cathepsin B-like cysteine proteinase [I... 63 5e-08 gb|AAK69541.1|AF283476_1 cathepsin B-like cysteine proteinase [I... 63 5e-08 ref|XP_006418358.1| hypothetical protein EUTSA_v10008009mg [Eutr... 62 6e-08 tpg|DAA62886.1| TPA: hypothetical protein ZEAMMB73_253741 [Zea m... 62 6e-08 tpg|DAA62884.1| TPA: cathepsin B-like cysteine proteinase 3 [Zea... 62 6e-08 ref|NP_001150152.1| LOC100283781 precursor [Zea mays] gi|1956371... 62 6e-08 >gb|AAC24376.1| cathepsin B-like cysteine proteinase [Arabidopsis thaliana] Length = 357 Score = 64.7 bits (156), Expect = 1e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEP YPTPKCE++ Sbjct: 190 ECDPYFDNTGCSHPGCEPTYPTPKCERK 217 >ref|NP_563647.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|332189291|gb|AEE27412.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana] Length = 379 Score = 64.7 bits (156), Expect = 1e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEP YPTPKCE++ Sbjct: 212 ECDPYFDNTGCSHPGCEPTYPTPKCERK 239 >dbj|BAD94873.1| cathepsin B-like cysteine proteinase like protein [Arabidopsis thaliana] Length = 183 Score = 64.7 bits (156), Expect = 1e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEP YPTPKCE++ Sbjct: 16 ECDPYFDNTGCSHPGCEPTYPTPKCERK 43 >ref|XP_006288020.1| hypothetical protein CARUB_v10001253mg [Capsella rubella] gi|482556726|gb|EOA20918.1| hypothetical protein CARUB_v10001253mg [Capsella rubella] Length = 359 Score = 64.3 bits (155), Expect = 2e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEPAYPTPKC ++ Sbjct: 192 ECDPYFDNTGCSHPGCEPAYPTPKCSRK 219 >ref|NP_849281.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|3859606|gb|AAC72872.1| contains similarity to cysteine proteases (Pfam: PF00112, E=1.3e-79, N=1) [Arabidopsis thaliana] gi|7268205|emb|CAB77732.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|332656653|gb|AEE82053.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana] Length = 359 Score = 64.3 bits (155), Expect = 2e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEPAYPTPKC ++ Sbjct: 192 ECDPYFDNTGCSHPGCEPAYPTPKCSRK 219 >ref|NP_567215.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|13877861|gb|AAK44008.1|AF370193_1 putative cathepsin B cysteine protease [Arabidopsis thaliana] gi|17473834|gb|AAL38343.1| unknown protein [Arabidopsis thaliana] gi|21281113|gb|AAM45063.1| putative cathepsin B cysteine protease [Arabidopsis thaliana] gi|21554165|gb|AAM63244.1| cathepsin B-like cysteine protease, putative [Arabidopsis thaliana] gi|24417490|gb|AAN60355.1| unknown [Arabidopsis thaliana] gi|24899725|gb|AAN65077.1| unknown protein [Arabidopsis thaliana] gi|51968702|dbj|BAD43043.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|51969104|dbj|BAD43244.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|51969220|dbj|BAD43302.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|51970472|dbj|BAD43928.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|51970630|dbj|BAD44007.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|51970704|dbj|BAD44044.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|51970802|dbj|BAD44093.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|51970974|dbj|BAD44179.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|51971008|dbj|BAD44196.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|51971116|dbj|BAD44250.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|62320144|dbj|BAD94342.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|110740287|dbj|BAF02040.1| cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|332656652|gb|AEE82052.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana] Length = 359 Score = 64.3 bits (155), Expect = 2e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEPAYPTPKC ++ Sbjct: 192 ECDPYFDNTGCSHPGCEPAYPTPKCSRK 219 >gb|ABF47216.1| cathepsin B [Nicotiana benthamiana] Length = 356 Score = 64.3 bits (155), Expect = 2e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEPAYPTPKC ++ Sbjct: 189 ECDPYFDNEGCSHPGCEPAYPTPKCHRK 216 >emb|CAA57522.1| cathepsin B-like cysteine proteinase [Nicotiana rustica] Length = 356 Score = 64.3 bits (155), Expect = 2e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEPAYPTPKC ++ Sbjct: 189 ECDPYFDNEGCSHPGCEPAYPTPKCHRK 216 >ref|NP_563648.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana] gi|16226808|gb|AAL16267.1|AF428337_1 At1g02300/T6A9_10 [Arabidopsis thaliana] gi|14532526|gb|AAK63991.1| At1g02300/T6A9_10 [Arabidopsis thaliana] gi|25090140|gb|AAN72238.1| At1g02300/T6A9_10 [Arabidopsis thaliana] gi|332189292|gb|AEE27413.1| putative cathepsin B-like cysteine protease [Arabidopsis thaliana] Length = 362 Score = 63.9 bits (154), Expect = 2e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEPAYPTPKC ++ Sbjct: 195 ECDPYFDNTGCSHPGCEPAYPTPKCARK 222 >ref|XP_002889395.1| hypothetical protein ARALYDRAFT_887368 [Arabidopsis lyrata subsp. lyrata] gi|297335237|gb|EFH65654.1| hypothetical protein ARALYDRAFT_887368 [Arabidopsis lyrata subsp. lyrata] Length = 360 Score = 63.9 bits (154), Expect = 2e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEPAYPTPKC ++ Sbjct: 193 ECDPYFDNTGCSHPGCEPAYPTPKCARK 220 >dbj|BAH20325.1| AT1G02305 [Arabidopsis thaliana] Length = 293 Score = 63.9 bits (154), Expect = 2e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEPAYPTPKC ++ Sbjct: 126 ECDPYFDNTGCSHPGCEPAYPTPKCARK 153 >ref|XP_006305170.1| hypothetical protein CARUB_v10009537mg [Capsella rubella] gi|482573881|gb|EOA38068.1| hypothetical protein CARUB_v10009537mg [Capsella rubella] Length = 360 Score = 63.5 bits (153), Expect = 3e-08 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEPAYPTPKC ++ Sbjct: 193 ECDPYFDNTGCSHPGCEPAYPTPKCVRK 220 >gb|EXB94879.1| Cathepsin B [Morus notabilis] Length = 420 Score = 63.2 bits (152), Expect = 4e-08 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEPAYPTP+C ++ Sbjct: 192 ECDPYFDNTGCSHPGCEPAYPTPRCHRK 219 >ref|XP_004978395.1| PREDICTED: cathepsin B-like [Setaria italica] Length = 236 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -2 Query: 92 LWQCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 L QCDPYFD GC HPGCEPAYPTP CEK+ Sbjct: 69 LLQCDPYFDQVGCNHPGCEPAYPTPVCEKK 98 >gb|AAF04727.1|AF101239_1 cathepsin B-like cysteine proteinase [Ipomoea batatas] Length = 352 Score = 62.8 bits (151), Expect = 5e-08 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFD GC+HPGCEPAYPTP CEK+ Sbjct: 185 ECDPYFDQTGCSHPGCEPAYPTPACEKK 212 >gb|AAK69541.1|AF283476_1 cathepsin B-like cysteine proteinase [Ipomoea batatas] Length = 352 Score = 62.8 bits (151), Expect = 5e-08 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFD GC+HPGCEPAYPTP CEK+ Sbjct: 185 ECDPYFDQTGCSHPGCEPAYPTPACEKK 212 >ref|XP_006418358.1| hypothetical protein EUTSA_v10008009mg [Eutrema salsugineum] gi|557096129|gb|ESQ36711.1| hypothetical protein EUTSA_v10008009mg [Eutrema salsugineum] Length = 360 Score = 62.4 bits (150), Expect = 6e-08 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFDN GC+HPGCEPAYPTP+C ++ Sbjct: 193 ECDPYFDNTGCSHPGCEPAYPTPRCVRK 220 >tpg|DAA62886.1| TPA: hypothetical protein ZEAMMB73_253741 [Zea mays] gi|414886873|tpg|DAA62887.1| TPA: hypothetical protein ZEAMMB73_253741 [Zea mays] Length = 208 Score = 62.4 bits (150), Expect = 6e-08 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFD GC HPGCEPAYPTPKCEK+ Sbjct: 43 ECDPYFDPVGCKHPGCEPAYPTPKCEKK 70 >tpg|DAA62884.1| TPA: cathepsin B-like cysteine proteinase 3 [Zea mays] Length = 347 Score = 62.4 bits (150), Expect = 6e-08 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFD GC HPGCEPAYPTPKCEK+ Sbjct: 182 ECDPYFDPVGCKHPGCEPAYPTPKCEKK 209 >ref|NP_001150152.1| LOC100283781 precursor [Zea mays] gi|195637168|gb|ACG38052.1| cathepsin B-like cysteine proteinase 3 precursor [Zea mays] Length = 347 Score = 62.4 bits (150), Expect = 6e-08 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -2 Query: 86 QCDPYFDNNGCTHPGCEPAYPTPKCEKR 3 +CDPYFD GC HPGCEPAYPTPKCEK+ Sbjct: 182 ECDPYFDPVGCKHPGCEPAYPTPKCEKK 209