BLASTX nr result
ID: Rehmannia25_contig00011427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00011427 (446 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004246711.1| PREDICTED: uncharacterized protein LOC101262... 61 1e-07 gb|EXB84829.1| TBC1 domain family member 8B [Morus notabilis] 55 1e-05 >ref|XP_004246711.1| PREDICTED: uncharacterized protein LOC101262244 [Solanum lycopersicum] Length = 797 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/60 (53%), Positives = 40/60 (66%) Frame = -2 Query: 445 DSPQDMPTKKTGLLSFGLGWRDRNKGKPSNDMASPGESRFKNDGSDQSNTDGDTDHGHQE 266 DSPQ P K+TGLLSFGLGWRDRNK KPSN E + ++G + S+T + +G QE Sbjct: 743 DSPQGAPAKRTGLLSFGLGWRDRNKAKPSN----LNEMKSADEGPEMSSTATEA-NGQQE 797 >gb|EXB84829.1| TBC1 domain family member 8B [Morus notabilis] Length = 895 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/52 (53%), Positives = 32/52 (61%) Frame = -2 Query: 424 TKKTGLLSFGLGWRDRNKGKPSNDMASPGESRFKNDGSDQSNTDGDTDHGHQ 269 T+KTGLL FGLGWRDRNKGKP+N P ES+ N+ D S T Q Sbjct: 845 TRKTGLLPFGLGWRDRNKGKPTNS-EEPSESKTTNELIDLSTQQKKTSEQEQ 895