BLASTX nr result
ID: Rehmannia25_contig00011167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00011167 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY00603.1| F-box family protein isoform 1 [Theobroma cacao] ... 67 2e-09 ref|XP_002527920.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 emb|CBI23367.3| unnamed protein product [Vitis vinifera] 66 4e-09 ref|XP_002273705.1| PREDICTED: F-box protein At1g70590 [Vitis vi... 66 4e-09 ref|XP_002315673.1| hypothetical protein POPTR_0010s05550g [Popu... 65 7e-09 gb|EPS71841.1| hypothetical protein M569_02918, partial [Genlise... 62 1e-07 ref|XP_006483936.1| PREDICTED: F-box protein At1g70590-like [Cit... 61 2e-07 ref|XP_006438282.1| hypothetical protein CICLE_v10032010mg [Citr... 61 2e-07 ref|XP_006438281.1| hypothetical protein CICLE_v10032010mg [Citr... 61 2e-07 ref|XP_006438280.1| hypothetical protein CICLE_v10032010mg [Citr... 61 2e-07 ref|XP_004142966.1| PREDICTED: F-box protein At1g70590-like isof... 59 9e-07 gb|EMJ23695.1| hypothetical protein PRUPE_ppa008243mg [Prunus pe... 57 3e-06 gb|EXB82524.1| F-box protein [Morus notabilis] 56 4e-06 gb|ESW30403.1| hypothetical protein PHAVU_002G150600g [Phaseolus... 55 7e-06 ref|XP_006357611.1| PREDICTED: F-box protein At1g70590-like [Sol... 55 1e-05 ref|XP_004239122.1| PREDICTED: F-box protein At1g70590-like [Sol... 55 1e-05 ref|XP_003519795.1| PREDICTED: F-box protein At1g70590-like [Gly... 55 1e-05 ref|XP_003517527.1| PREDICTED: F-box protein At1g70590-like [Gly... 55 1e-05 >gb|EOY00603.1| F-box family protein isoform 1 [Theobroma cacao] gi|508708707|gb|EOY00604.1| F-box family protein isoform 1 [Theobroma cacao] Length = 334 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPASR 119 +GE AA HVKNVILQQLS+TSRDRA+LLAD WRALP+SR Sbjct: 296 SGETAATHVKNVILQQLSATSRDRAMLLADNWRALPSSR 334 >ref|XP_002527920.1| conserved hypothetical protein [Ricinus communis] gi|223532695|gb|EEF34477.1| conserved hypothetical protein [Ricinus communis] Length = 329 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPAS 116 AGE AAAHVKNVILQQLS+TSRDR +LLAD+WRALP+S Sbjct: 291 AGETAAAHVKNVILQQLSTTSRDRVMLLADSWRALPSS 328 >emb|CBI23367.3| unnamed protein product [Vitis vinifera] Length = 193 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPAS 116 AGE AAAHVKNVILQQLS TSRDRA+LLAD WRALP S Sbjct: 155 AGETAAAHVKNVILQQLSVTSRDRAMLLADNWRALPTS 192 >ref|XP_002273705.1| PREDICTED: F-box protein At1g70590 [Vitis vinifera] Length = 335 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPAS 116 AGE AAAHVKNVILQQLS TSRDRA+LLAD WRALP S Sbjct: 297 AGETAAAHVKNVILQQLSVTSRDRAMLLADNWRALPTS 334 >ref|XP_002315673.1| hypothetical protein POPTR_0010s05550g [Populus trichocarpa] gi|566189237|ref|XP_006378237.1| F-box family protein [Populus trichocarpa] gi|222864713|gb|EEF01844.1| hypothetical protein POPTR_0010s05550g [Populus trichocarpa] gi|550329141|gb|ERP56034.1| F-box family protein [Populus trichocarpa] Length = 334 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPASR 119 AGE AAAHVKNVILQQLS+TSRDR + LAD WRALP+SR Sbjct: 296 AGETAAAHVKNVILQQLSATSRDRVMNLADNWRALPSSR 334 >gb|EPS71841.1| hypothetical protein M569_02918, partial [Genlisea aurea] Length = 337 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRAL 107 AGERAAAHVKNVILQQLS+ SRDRA+LLAD+WR L Sbjct: 303 AGERAAAHVKNVILQQLSAPSRDRAMLLADSWRPL 337 >ref|XP_006483936.1| PREDICTED: F-box protein At1g70590-like [Citrus sinensis] Length = 342 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPA 113 AGE AA HVKNVILQQLS+TSRDRA+L+ D+WRA+P+ Sbjct: 304 AGETAADHVKNVILQQLSATSRDRAMLVVDSWRAMPS 340 >ref|XP_006438282.1| hypothetical protein CICLE_v10032010mg [Citrus clementina] gi|557540478|gb|ESR51522.1| hypothetical protein CICLE_v10032010mg [Citrus clementina] Length = 336 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPA 113 AGE AA HVKNVILQQLS+TSRDRA+L+ D+WRA+P+ Sbjct: 298 AGETAADHVKNVILQQLSATSRDRAMLVVDSWRAMPS 334 >ref|XP_006438281.1| hypothetical protein CICLE_v10032010mg [Citrus clementina] gi|557540477|gb|ESR51521.1| hypothetical protein CICLE_v10032010mg [Citrus clementina] Length = 342 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPA 113 AGE AA HVKNVILQQLS+TSRDRA+L+ D+WRA+P+ Sbjct: 304 AGETAADHVKNVILQQLSATSRDRAMLVVDSWRAMPS 340 >ref|XP_006438280.1| hypothetical protein CICLE_v10032010mg [Citrus clementina] gi|557540476|gb|ESR51520.1| hypothetical protein CICLE_v10032010mg [Citrus clementina] Length = 331 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPA 113 AGE AA HVKNVILQQLS+TSRDRA+L+ D+WRA+P+ Sbjct: 293 AGETAADHVKNVILQQLSATSRDRAMLVVDSWRAMPS 329 >ref|XP_004142966.1| PREDICTED: F-box protein At1g70590-like isoform 1 [Cucumis sativus] gi|449500305|ref|XP_004161061.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein At1g70590-like [Cucumis sativus] Length = 368 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPAS 116 +GERAA HVKNVILQQLS +SRDR + +AD WR LP+S Sbjct: 330 SGERAAGHVKNVILQQLSQSSRDRVMSVADNWRPLPSS 367 >gb|EMJ23695.1| hypothetical protein PRUPE_ppa008243mg [Prunus persica] Length = 340 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 6 GERAAAHVKNVILQQLSSTSRDRAILLADTWRALPAS 116 GE A+AHVK+VILQQLS TSRD +LL D WRALP+S Sbjct: 303 GESASAHVKDVILQQLSETSRDDVMLLVDQWRALPSS 339 >gb|EXB82524.1| F-box protein [Morus notabilis] Length = 341 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +3 Query: 6 GERAAAHVKNVILQQLSSTSRDRAILLADTWRALPAS 116 GE AHVKNVILQQLS+TSRDR + LAD W A P+S Sbjct: 300 GETGGAHVKNVILQQLSATSRDRVVHLADNWHAFPSS 336 >gb|ESW30403.1| hypothetical protein PHAVU_002G150600g [Phaseolus vulgaris] Length = 370 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPA 113 AGE+ AAHVKN +L +LSS SRD A+ LAD+WRALP+ Sbjct: 333 AGEKGAAHVKNAVLHRLSSASRDHAMHLADSWRALPS 369 >ref|XP_006357611.1| PREDICTED: F-box protein At1g70590-like [Solanum tuberosum] Length = 351 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPAS 116 AGE AA HVK VILQ++S++ RDRA+LLAD WR LP+S Sbjct: 312 AGETAADHVKYVILQEMSTSCRDRAMLLADNWRPLPSS 349 >ref|XP_004239122.1| PREDICTED: F-box protein At1g70590-like [Solanum lycopersicum] Length = 349 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPAS 116 AGE AA HVK VILQ++S++ RDRA+LLAD WR LP+S Sbjct: 310 AGETAADHVKYVILQEMSTSCRDRAMLLADNWRPLPSS 347 >ref|XP_003519795.1| PREDICTED: F-box protein At1g70590-like [Glycine max] Length = 327 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPAS 116 AGE+ AAHVKN +L +LSS SRD A+ LA++WRALP+S Sbjct: 290 AGEKGAAHVKNAVLHRLSSASRDHAMHLANSWRALPSS 327 >ref|XP_003517527.1| PREDICTED: F-box protein At1g70590-like [Glycine max] Length = 327 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 3 AGERAAAHVKNVILQQLSSTSRDRAILLADTWRALPAS 116 AGE+ AAHVKN +L +LSS SRD A+ LA++WRALP+S Sbjct: 290 AGEKGAAHVKNAVLHRLSSVSRDHAMHLANSWRALPSS 327