BLASTX nr result
ID: Rehmannia25_contig00011148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00011148 (312 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ10833.1| hypothetical protein PRUPE_ppa011860mg [Prunus pe... 62 1e-07 ref|XP_004298948.1| PREDICTED: 50S ribosomal protein L7/L12-like... 59 9e-07 >gb|EMJ10833.1| hypothetical protein PRUPE_ppa011860mg [Prunus persica] gi|462405370|gb|EMJ10834.1| hypothetical protein PRUPE_ppa011860mg [Prunus persica] Length = 193 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = +3 Query: 171 MKVATLYRIARAHPALCGKTNLIQYRCFQPDFVPRDPKAKPTRYKYP 311 M++ L R RA P L T +Q+RCFQPDF PRDP AKP +YKYP Sbjct: 1 MRLVALARSFRARPTLPETTGPLQFRCFQPDFAPRDPDAKPKKYKYP 47 >ref|XP_004298948.1| PREDICTED: 50S ribosomal protein L7/L12-like [Fragaria vesca subsp. vesca] Length = 193 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/47 (55%), Positives = 31/47 (65%) Frame = +3 Query: 171 MKVATLYRIARAHPALCGKTNLIQYRCFQPDFVPRDPKAKPTRYKYP 311 M++ + R+ A P L T +Q R FQPDF PRDPKAKP RYKYP Sbjct: 1 MRIVAVARLFHARPTLPKATGHLQVRAFQPDFKPRDPKAKPIRYKYP 47