BLASTX nr result
ID: Rehmannia25_contig00011063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00011063 (340 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW31814.1| hypothetical protein PHAVU_002G270200g [Phaseolus... 45 1e-06 >gb|ESW31814.1| hypothetical protein PHAVU_002G270200g [Phaseolus vulgaris] Length = 75 Score = 45.1 bits (105), Expect(2) = 1e-06 Identities = 21/37 (56%), Positives = 24/37 (64%) Frame = -3 Query: 236 SSSSGHFSNLMPKKRIPAASAPSRKHNDLGLRSRRFP 126 S GHFS +PK+ S PSRKHND+GLRS R P Sbjct: 39 SQHHGHFSGFLPKRMPIPYSTPSRKHNDIGLRSWRSP 75 Score = 33.1 bits (74), Expect(2) = 1e-06 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -1 Query: 340 LVVFILILGRCSCSRATNAFKIRSNIQ 260 L +F+ +LG C SRATN +K+R Q Sbjct: 14 LFLFLFVLGHCHASRATNVYKLRPKSQ 40