BLASTX nr result
ID: Rehmannia25_contig00010863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00010863 (866 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270184.2| PREDICTED: pentatricopeptide repeat-containi... 112 2e-22 ref|XP_003531588.2| PREDICTED: pentatricopeptide repeat-containi... 111 4e-22 ref|XP_004141206.1| PREDICTED: pentatricopeptide repeat-containi... 110 5e-22 ref|XP_004486236.1| PREDICTED: pentatricopeptide repeat-containi... 110 7e-22 ref|XP_002299667.2| hypothetical protein POPTR_0001s21880g [Popu... 110 9e-22 ref|XP_006343484.1| PREDICTED: pentatricopeptide repeat-containi... 109 1e-21 ref|XP_006343482.1| PREDICTED: pentatricopeptide repeat-containi... 109 1e-21 ref|XP_006343481.1| PREDICTED: pentatricopeptide repeat-containi... 109 1e-21 ref|XP_006385214.1| hypothetical protein POPTR_0003s01320g [Popu... 109 1e-21 ref|XP_003593032.1| Pentatricopeptide repeat-containing protein ... 108 3e-21 gb|ESW20506.1| hypothetical protein PHAVU_006G214900g [Phaseolus... 107 4e-21 ref|XP_006417404.1| hypothetical protein EUTSA_v10007006mg [Eutr... 105 2e-20 ref|XP_006343483.1| PREDICTED: pentatricopeptide repeat-containi... 105 2e-20 ref|XP_004299940.1| PREDICTED: pentatricopeptide repeat-containi... 105 2e-20 gb|AAB65486.1| membrane-associated salt-inducible protein isolog... 105 3e-20 ref|NP_172560.2| pentatricopeptide repeat-containing protein [Ar... 105 3e-20 ref|XP_002529286.1| pentatricopeptide repeat-containing protein,... 103 1e-19 gb|EXB36427.1| hypothetical protein L484_009994 [Morus notabilis] 102 1e-19 ref|XP_004250704.1| PREDICTED: pentatricopeptide repeat-containi... 102 2e-19 gb|EMJ26349.1| hypothetical protein PRUPE_ppa002505mg [Prunus pe... 101 3e-19 >ref|XP_002270184.2| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Vitis vinifera] gi|298204537|emb|CBI23812.3| unnamed protein product [Vitis vinifera] Length = 659 Score = 112 bits (280), Expect = 2e-22 Identities = 51/73 (69%), Positives = 62/73 (84%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SGYKIDQ++F MAV+RYI +PEKKELLLHLLQWMPGQG+ +DSS RN+ILKNSHLFG Sbjct: 582 SGYKIDQELFQMAVTRYIAEPEKKELLLHLLQWMPGQGYVVDSSTRNMILKNSHLFGRQL 641 Query: 686 ISELMSKHYTALK 648 I+E++SK + K Sbjct: 642 IAEMLSKQHARAK 654 >ref|XP_003531588.2| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like [Glycine max] Length = 646 Score = 111 bits (277), Expect = 4e-22 Identities = 51/72 (70%), Positives = 61/72 (84%) Frame = -1 Query: 863 GYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHSI 684 GYK+DQD+F MAVSRY++QPEKK+LLLHLLQWM GQG+ +DSS RNLILKNSHLFG I Sbjct: 569 GYKLDQDLFAMAVSRYLDQPEKKDLLLHLLQWMAGQGYAVDSSTRNLILKNSHLFGRQLI 628 Query: 683 SELMSKHYTALK 648 +E++SK LK Sbjct: 629 AEVLSKQQVKLK 640 >ref|XP_004141206.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like [Cucumis sativus] Length = 668 Score = 110 bits (276), Expect = 5e-22 Identities = 51/79 (64%), Positives = 63/79 (79%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SGYKIDQD+F +A SRYIE PEKK+L + LL+WMPGQG+ +DSS RNLILKN+HLFG Sbjct: 584 SGYKIDQDLFMIATSRYIELPEKKDLFIQLLKWMPGQGYVVDSSTRNLILKNAHLFGRQL 643 Query: 686 ISELMSKHYTALKTNKSHE 630 I+E++SKH K+ KS E Sbjct: 644 IAEILSKHSLLSKSTKSRE 662 >ref|XP_004486236.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like [Cicer arietinum] Length = 642 Score = 110 bits (275), Expect = 7e-22 Identities = 51/72 (70%), Positives = 61/72 (84%) Frame = -1 Query: 863 GYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHSI 684 GYKIDQD+F MAV+RY+ QPEKK+LLLHLLQWMPGQG+ +D S RNLILKNSHLFG I Sbjct: 565 GYKIDQDLFEMAVTRYLGQPEKKDLLLHLLQWMPGQGYVVDPSTRNLILKNSHLFGRQLI 624 Query: 683 SELMSKHYTALK 648 +E++SK +LK Sbjct: 625 AEVLSKQRVSLK 636 >ref|XP_002299667.2| hypothetical protein POPTR_0001s21880g [Populus trichocarpa] gi|550347847|gb|EEE84472.2| hypothetical protein POPTR_0001s21880g [Populus trichocarpa] Length = 673 Score = 110 bits (274), Expect = 9e-22 Identities = 51/77 (66%), Positives = 63/77 (81%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SGYKIDQ++F MAVSRYI +PEKK+LL+ LLQWMPGQG+ +DSS RNLILKNSHLFG Sbjct: 596 SGYKIDQELFLMAVSRYIAEPEKKDLLIQLLQWMPGQGYVVDSSTRNLILKNSHLFGRQL 655 Query: 686 ISELMSKHYTALKTNKS 636 I+E++SK + K K+ Sbjct: 656 IAEILSKQHMTSKALKA 672 >ref|XP_006343484.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like isoform X4 [Solanum tuberosum] Length = 539 Score = 109 bits (273), Expect = 1e-21 Identities = 52/83 (62%), Positives = 65/83 (78%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SG+KIDQ++F +A++RYI +PEKKELLL LL+WMPG+G+ IDSS RNLILKNSHLFGH Sbjct: 457 SGHKIDQELFDLAIARYIAKPEKKELLLWLLKWMPGKGYAIDSSTRNLILKNSHLFGHQL 516 Query: 686 ISELMSKHYTALKTNKSHEGRTR 618 I+E +SKH K K H+ R Sbjct: 517 IAESLSKHLVMSKKVKLHKENAR 539 >ref|XP_006343482.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 651 Score = 109 bits (273), Expect = 1e-21 Identities = 52/83 (62%), Positives = 65/83 (78%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SG+KIDQ++F +A++RYI +PEKKELLL LL+WMPG+G+ IDSS RNLILKNSHLFGH Sbjct: 569 SGHKIDQELFDLAIARYIAKPEKKELLLWLLKWMPGKGYAIDSSTRNLILKNSHLFGHQL 628 Query: 686 ISELMSKHYTALKTNKSHEGRTR 618 I+E +SKH K K H+ R Sbjct: 629 IAESLSKHLVMSKKVKLHKENAR 651 >ref|XP_006343481.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 652 Score = 109 bits (273), Expect = 1e-21 Identities = 52/83 (62%), Positives = 65/83 (78%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SG+KIDQ++F +A++RYI +PEKKELLL LL+WMPG+G+ IDSS RNLILKNSHLFGH Sbjct: 570 SGHKIDQELFDLAIARYIAKPEKKELLLWLLKWMPGKGYAIDSSTRNLILKNSHLFGHQL 629 Query: 686 ISELMSKHYTALKTNKSHEGRTR 618 I+E +SKH K K H+ R Sbjct: 630 IAESLSKHLVMSKKVKLHKENAR 652 >ref|XP_006385214.1| hypothetical protein POPTR_0003s01320g [Populus trichocarpa] gi|550342119|gb|ERP63011.1| hypothetical protein POPTR_0003s01320g [Populus trichocarpa] Length = 154 Score = 109 bits (272), Expect = 1e-21 Identities = 53/78 (67%), Positives = 62/78 (79%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SGYKIDQ +F MAVSRYI QPEKK+LLL LLQWM GQG+ +DSS RNLILKN+HLFG Sbjct: 72 SGYKIDQRLFQMAVSRYIAQPEKKDLLLQLLQWMRGQGYVVDSSTRNLILKNAHLFGQQF 131 Query: 686 ISELMSKHYTALKTNKSH 633 I+E++SK + K KSH Sbjct: 132 IAEILSKKHMMSKALKSH 149 >ref|XP_003593032.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355482080|gb|AES63283.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 627 Score = 108 bits (270), Expect = 3e-21 Identities = 52/77 (67%), Positives = 61/77 (79%) Frame = -1 Query: 863 GYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHSI 684 GYKIDQ +F MAVSRY+ QPEKK+LLLHLLQWMPGQG+ I+ S RNLILKNSHLFG I Sbjct: 551 GYKIDQGLFEMAVSRYLGQPEKKDLLLHLLQWMPGQGYVINPSTRNLILKNSHLFGRQLI 610 Query: 683 SELMSKHYTALKTNKSH 633 +E++SK L KS+ Sbjct: 611 AEVLSKQRVKLNAQKSN 627 >gb|ESW20506.1| hypothetical protein PHAVU_006G214900g [Phaseolus vulgaris] Length = 639 Score = 107 bits (268), Expect = 4e-21 Identities = 50/73 (68%), Positives = 61/73 (83%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SGYK+DQD+F MAVSRY+ +PEKK+LLLHLLQWM GQG+ +DSS RNLILK+SHLFG Sbjct: 561 SGYKLDQDLFAMAVSRYLGEPEKKDLLLHLLQWMSGQGYMVDSSTRNLILKHSHLFGRQL 620 Query: 686 ISELMSKHYTALK 648 I+E++SK LK Sbjct: 621 IAEVLSKQQVQLK 633 >ref|XP_006417404.1| hypothetical protein EUTSA_v10007006mg [Eutrema salsugineum] gi|557095175|gb|ESQ35757.1| hypothetical protein EUTSA_v10007006mg [Eutrema salsugineum] Length = 666 Score = 105 bits (263), Expect = 2e-20 Identities = 50/74 (67%), Positives = 62/74 (83%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SG+KIDQ F +A+SRYI QP+KKELLL LLQWMPGQG+ +DSS RNLILKNS+LFG Sbjct: 579 SGHKIDQVQFEIAISRYISQPDKKELLLQLLQWMPGQGYVVDSSTRNLILKNSNLFGRQL 638 Query: 686 ISELMSKHYTALKT 645 I+E++SKH+ A +T Sbjct: 639 IAEILSKHHIASRT 652 >ref|XP_006343483.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like isoform X3 [Solanum tuberosum] Length = 646 Score = 105 bits (262), Expect = 2e-20 Identities = 49/73 (67%), Positives = 61/73 (83%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SG+KIDQ++F +A++RYI +PEKKELLL LL+WMPG+G+ IDSS RNLILKNSHLFGH Sbjct: 570 SGHKIDQELFDLAIARYIAKPEKKELLLWLLKWMPGKGYAIDSSTRNLILKNSHLFGHQL 629 Query: 686 ISELMSKHYTALK 648 I+E +SKH K Sbjct: 630 IAESLSKHLVMSK 642 >ref|XP_004299940.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 642 Score = 105 bits (262), Expect = 2e-20 Identities = 50/77 (64%), Positives = 60/77 (77%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SG KIDQ IF MA+SRYI P+KK+LLL LLQWMPGQG+ +DSS RNLILKNSHLF Sbjct: 565 SGCKIDQGIFQMAISRYISDPDKKDLLLQLLQWMPGQGYTVDSSTRNLILKNSHLFDRQH 624 Query: 686 ISELMSKHYTALKTNKS 636 I+E++SK + K +KS Sbjct: 625 IAEMLSKQHMISKASKS 641 >gb|AAB65486.1| membrane-associated salt-inducible protein isolog; 88078-84012 [Arabidopsis thaliana] Length = 652 Score = 105 bits (261), Expect = 3e-20 Identities = 49/71 (69%), Positives = 60/71 (84%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SG+KIDQ F +A+SRYI QP+KKELLL LLQWMPGQG+ +DSS RNLILKNSH+FG Sbjct: 566 SGHKIDQVQFEIAISRYISQPDKKELLLQLLQWMPGQGYVVDSSTRNLILKNSHMFGRLL 625 Query: 686 ISELMSKHYTA 654 I+E++SKH+ A Sbjct: 626 IAEILSKHHVA 636 >ref|NP_172560.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122242678|sp|Q0WVV0.1|PPR31_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g10910, chloroplastic; Flags: Precursor gi|110741600|dbj|BAE98748.1| membrane-associated salt-inducible protein isolog [Arabidopsis thaliana] gi|332190541|gb|AEE28662.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 664 Score = 105 bits (261), Expect = 3e-20 Identities = 49/71 (69%), Positives = 60/71 (84%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SG+KIDQ F +A+SRYI QP+KKELLL LLQWMPGQG+ +DSS RNLILKNSH+FG Sbjct: 578 SGHKIDQVQFEIAISRYISQPDKKELLLQLLQWMPGQGYVVDSSTRNLILKNSHMFGRLL 637 Query: 686 ISELMSKHYTA 654 I+E++SKH+ A Sbjct: 638 IAEILSKHHVA 648 >ref|XP_002529286.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531275|gb|EEF33118.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 672 Score = 103 bits (256), Expect = 1e-19 Identities = 50/79 (63%), Positives = 63/79 (79%), Gaps = 2/79 (2%) Frame = -1 Query: 866 SGYKIDQ--DIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGH 693 SGYKIDQ ++F MA+SRYI QPEKK+LL+ LLQWMPG G+ +D+S RNLILK+SHLFG Sbjct: 593 SGYKIDQASELFQMAISRYIAQPEKKDLLVQLLQWMPGHGYVVDASTRNLILKSSHLFGR 652 Query: 692 HSISELMSKHYTALKTNKS 636 I+E++SK + KT KS Sbjct: 653 QLIAEILSKQHIISKTLKS 671 >gb|EXB36427.1| hypothetical protein L484_009994 [Morus notabilis] Length = 377 Score = 102 bits (255), Expect = 1e-19 Identities = 49/77 (63%), Positives = 61/77 (79%) Frame = -1 Query: 863 GYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHSI 684 G KIDQD+F MA+SRYI +PEKK+LLL LLQWM G G+ ++SS RNLILKNSHLFG I Sbjct: 301 GCKIDQDLFRMAISRYIMKPEKKDLLLQLLQWMSGNGYVVNSSTRNLILKNSHLFGRQLI 360 Query: 683 SELMSKHYTALKTNKSH 633 +E++SK LK +KS+ Sbjct: 361 AEILSKQQMMLKASKSN 377 >ref|XP_004250704.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like [Solanum lycopersicum] Length = 642 Score = 102 bits (253), Expect = 2e-19 Identities = 48/73 (65%), Positives = 60/73 (82%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SG+KIDQ++F +A++RYI +PEKKELLL LL+WMP +G+ IDSS RNLILKNSHLFGH Sbjct: 569 SGHKIDQELFDLAIARYIAKPEKKELLLWLLKWMPVKGYAIDSSTRNLILKNSHLFGHQL 628 Query: 686 ISELMSKHYTALK 648 I+E +SKH K Sbjct: 629 IAESLSKHLVMSK 641 >gb|EMJ26349.1| hypothetical protein PRUPE_ppa002505mg [Prunus persica] Length = 664 Score = 101 bits (252), Expect = 3e-19 Identities = 47/79 (59%), Positives = 61/79 (77%) Frame = -1 Query: 866 SGYKIDQDIFYMAVSRYIEQPEKKELLLHLLQWMPGQGFPIDSSMRNLILKNSHLFGHHS 687 SG KIDQ +F MA+SRYI PEKKELL+ +L WMPGQG+ +DS+ RNLILKNSHLFG Sbjct: 581 SGCKIDQGLFQMAISRYIALPEKKELLIQMLLWMPGQGYVVDSATRNLILKNSHLFGRQH 640 Query: 686 ISELMSKHYTALKTNKSHE 630 I++++SK + K +KS + Sbjct: 641 IADVLSKQHMISKASKSRK 659