BLASTX nr result
ID: Rehmannia25_contig00010225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00010225 (555 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY08413.1| Gb:AAF02129.1 isoform 1 [Theobroma cacao] gi|5087... 59 8e-07 emb|CAN79170.1| hypothetical protein VITISV_012166 [Vitis vinifera] 58 2e-06 ref|XP_002530166.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_002323401.2| hypothetical protein POPTR_0016s07430g [Popu... 56 5e-06 >gb|EOY08413.1| Gb:AAF02129.1 isoform 1 [Theobroma cacao] gi|508716517|gb|EOY08414.1| Gb:AAF02129.1 isoform 1 [Theobroma cacao] Length = 113 Score = 58.9 bits (141), Expect = 8e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 449 MSRRNGPKLDLKLNLSPPRRSHPRVESPSRSSTVS 553 MSRRNGPKL+LKLNLSPP R +PRVESPSRS+TVS Sbjct: 1 MSRRNGPKLELKLNLSPP-RLNPRVESPSRSATVS 34 >emb|CAN79170.1| hypothetical protein VITISV_012166 [Vitis vinifera] Length = 281 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/63 (53%), Positives = 41/63 (65%), Gaps = 5/63 (7%) Frame = +2 Query: 380 PPPSEKPY-----TLPNRN*LIIGKQKKMSRRNGPKLDLKLNLSPPRRSHPRVESPSRSS 544 PPP P+ LP +G +MSRRNGPKLDLKLNLSPP R++ ESPSRS+ Sbjct: 135 PPPPALPFGWERHPLPQGK-RYLGDATRMSRRNGPKLDLKLNLSPP-RANRHAESPSRSA 192 Query: 545 TVS 553 T+S Sbjct: 193 TLS 195 >ref|XP_002530166.1| conserved hypothetical protein [Ricinus communis] gi|223530327|gb|EEF32221.1| conserved hypothetical protein [Ricinus communis] Length = 195 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/41 (75%), Positives = 36/41 (87%), Gaps = 2/41 (4%) Frame = +2 Query: 437 KQKKMSRRNG--PKLDLKLNLSPPRRSHPRVESPSRSSTVS 553 ++K MSRRNG PKLDLKLNLSPP R+ PRVESP+RS+TVS Sbjct: 83 RKKTMSRRNGNGPKLDLKLNLSPP-RADPRVESPNRSATVS 122 >ref|XP_002323401.2| hypothetical protein POPTR_0016s07430g [Populus trichocarpa] gi|550321046|gb|EEF05162.2| hypothetical protein POPTR_0016s07430g [Populus trichocarpa] Length = 144 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/41 (75%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +2 Query: 437 KQKKMSRRNG--PKLDLKLNLSPPRRSHPRVESPSRSSTVS 553 K +MSRRNG PKLDLKLNLSPP R +PRVESP RS+TVS Sbjct: 26 KTSRMSRRNGSLPKLDLKLNLSPP-RVNPRVESPGRSATVS 65