BLASTX nr result
ID: Rehmannia25_contig00009371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00009371 (540 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343994.1| PREDICTED: putative DNA-binding protein ESCA... 56 5e-06 >ref|XP_006343994.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum tuberosum] Length = 345 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = -2 Query: 539 RDEKHPFDQSAEKSLTPITAASSQTYTPNSGSSVWPPVSRPEVKYPQTDIDLMRG 375 RDE+ +SAEKS TP++A +Q T SG VWPP SR +V+ QT+IDL RG Sbjct: 295 RDEQ----ESAEKSSTPVSATLNQGPTSGSGRGVWPPTSRTDVRNSQTEIDLTRG 345