BLASTX nr result
ID: Rehmannia25_contig00008134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00008134 (331 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGZ16400.1| MYB7 [Scutellaria baicalensis] 60 2e-07 >gb|AGZ16400.1| MYB7 [Scutellaria baicalensis] Length = 280 Score = 60.5 bits (145), Expect = 2e-07 Identities = 39/65 (60%), Positives = 48/65 (73%), Gaps = 2/65 (3%) Frame = +1 Query: 70 YFNIDDGNDDQKFLTS-APDEKGENGNCFSEINPLD-YSIEEIKQLISTNNICNNMDFFH 243 Y N D ++ KFL S + +GENGN SE N LD YS+E+IKQLISTN+ICNN++FF Sbjct: 211 YSNGVDHVENHKFLISESHGGEGENGNFISE-NLLDNYSMEDIKQLISTNHICNNLNFF- 268 Query: 244 VDEIK 258 VDEIK Sbjct: 269 VDEIK 273