BLASTX nr result
ID: Rehmannia25_contig00007926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00007926 (305 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB17074.1| putative sugar transporter [Nicotiana langsdorffi... 62 6e-08 gb|EPS64962.1| hypothetical protein M569_09818 [Genlisea aurea] 57 3e-06 >gb|ABB17074.1| putative sugar transporter [Nicotiana langsdorffii x Nicotiana sanderae] Length = 552 Score = 62.4 bits (150), Expect = 6e-08 Identities = 37/76 (48%), Positives = 50/76 (65%), Gaps = 1/76 (1%) Frame = -1 Query: 227 ITGRNHVALCRRSPSFLANDKGFRVPFLRSATNRNSMKVGASSGE-AESFDSETIQQEVF 51 +T R+ RR+ SF+A + ++P L R +KV ASSGE AES ++E+ E F Sbjct: 30 VTARSLSQCTRRNCSFMARNNERKLPLL--PLGRLRLKVSASSGEEAESNNAESAYLEEF 87 Query: 50 AWSSVILPFVFPALGG 3 +WSSVILPF+FPALGG Sbjct: 88 SWSSVILPFLFPALGG 103 >gb|EPS64962.1| hypothetical protein M569_09818 [Genlisea aurea] Length = 127 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 6/74 (8%) Frame = -1 Query: 206 ALCRRSPS---FLANDKGFRVPFLRSATNRNSMKVGASSGEAESFDSE---TIQQEVFAW 45 A RR+ S F + D +P +S + R +K GASS E + S T Q EVFAW Sbjct: 4 ANARRASSRRDFFSVDGLSAIPLWQSRSGRELVKAGASSAEGDRLTSGSELTQQAEVFAW 63 Query: 44 SSVILPFVFPALGG 3 SSV+LPF+FPALGG Sbjct: 64 SSVLLPFLFPALGG 77