BLASTX nr result
ID: Rehmannia25_contig00007426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00007426 (343 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280187.1| PREDICTED: uncharacterized protein LOC100260... 58 1e-06 ref|XP_002279465.1| PREDICTED: uncharacterized protein LOC100266... 56 6e-06 emb|CAN78613.1| hypothetical protein VITISV_028923 [Vitis vinifera] 55 7e-06 >ref|XP_002280187.1| PREDICTED: uncharacterized protein LOC100260337 [Vitis vinifera] gi|297745939|emb|CBI15995.3| unnamed protein product [Vitis vinifera] Length = 315 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/46 (60%), Positives = 37/46 (80%), Gaps = 2/46 (4%) Frame = +2 Query: 17 MVDSDESSIRLKTFELQRPSGRPHGKIRVKLSLIER--PVDNYHTA 148 +VDSDES+ ++T EL+RPSGRP+GKIR+KL+L ER P +YH A Sbjct: 112 LVDSDESANSIRTLELRRPSGRPNGKIRIKLALRERPPPTPDYHIA 157 >ref|XP_002279465.1| PREDICTED: uncharacterized protein LOC100266706 [Vitis vinifera] Length = 267 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +2 Query: 5 LRDLMVDSDESSIRLKTFELQRPSGRPHGKIRVKLSLIERP 127 L+DL VDSD+S+ R+KTF+L+RPSGRP GKIRVKL++ ERP Sbjct: 98 LKDL-VDSDDSN-RIKTFQLRRPSGRPQGKIRVKLAIRERP 136 >emb|CAN78613.1| hypothetical protein VITISV_028923 [Vitis vinifera] Length = 609 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = +2 Query: 23 DSDESSIRLKTFELQRPSGRPHGKIRVKLSLIER--PVDNYHTA 148 DSDES+ ++T EL+RPSGRP+GKIR+KL+L ER P +YH A Sbjct: 94 DSDESANSIRTLELRRPSGRPNGKIRIKLALRERPPPTPDYHIA 137