BLASTX nr result
ID: Rehmannia25_contig00007225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00007225 (410 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27403.3| unnamed protein product [Vitis vinifera] 59 9e-07 ref|XP_002316001.1| phosphatidylinositol 3- and 4-kinase family ... 59 9e-07 ref|XP_002267025.1| PREDICTED: probable phosphatidylinositol 4-k... 59 9e-07 gb|ESW25456.1| hypothetical protein PHAVU_003G037500g [Phaseolus... 58 1e-06 ref|XP_004490265.1| PREDICTED: probable phosphatidylinositol 4-k... 58 1e-06 ref|XP_004146767.1| PREDICTED: probable phosphatidylinositol 4-k... 58 1e-06 ref|XP_003518796.1| PREDICTED: phosphatidylinositol 4-kinase gam... 58 1e-06 ref|XP_006573180.1| PREDICTED: phosphatidylinositol 4-kinase gam... 58 1e-06 ref|XP_002514582.1| inositol or phosphatidylinositol kinase, put... 56 4e-06 ref|XP_006306992.1| hypothetical protein CARUB_v10008568mg [Caps... 55 1e-05 >emb|CBI27403.3| unnamed protein product [Vitis vinifera] Length = 392 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 QELLNPAFAKRKSVTLGQRQRQRLGTSCKF 92 QELL PAFAKRKSVTLGQRQRQRLGTSC+F Sbjct: 363 QELLYPAFAKRKSVTLGQRQRQRLGTSCQF 392 >ref|XP_002316001.1| phosphatidylinositol 3- and 4-kinase family protein [Populus trichocarpa] gi|222865041|gb|EEF02172.1| phosphatidylinositol 3- and 4-kinase family protein [Populus trichocarpa] Length = 640 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 QELLNPAFAKRKSVTLGQRQRQRLGTSCKF 92 QELL PAFAKRKSVTLGQRQRQRLGTSC+F Sbjct: 611 QELLYPAFAKRKSVTLGQRQRQRLGTSCQF 640 >ref|XP_002267025.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta At1g26270 isoform 1 [Vitis vinifera] gi|147838249|emb|CAN76598.1| hypothetical protein VITISV_005885 [Vitis vinifera] Length = 640 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 QELLNPAFAKRKSVTLGQRQRQRLGTSCKF 92 QELL PAFAKRKSVTLGQRQRQRLGTSC+F Sbjct: 611 QELLYPAFAKRKSVTLGQRQRQRLGTSCQF 640 >gb|ESW25456.1| hypothetical protein PHAVU_003G037500g [Phaseolus vulgaris] Length = 642 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 QELLNPAFAKRKSVTLGQRQRQRLGTSCKF 92 QELL PAFAKRKS+TLGQRQRQRLGTSC+F Sbjct: 613 QELLYPAFAKRKSITLGQRQRQRLGTSCQF 642 >ref|XP_004490265.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta At1g26270-like [Cicer arietinum] Length = 638 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 QELLNPAFAKRKSVTLGQRQRQRLGTSCKF 92 QELL PAFAKRKS+TLGQRQRQRLGTSC+F Sbjct: 609 QELLYPAFAKRKSITLGQRQRQRLGTSCQF 638 >ref|XP_004146767.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta At1g26270-like [Cucumis sativus] gi|449523902|ref|XP_004168962.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta At1g26270-like [Cucumis sativus] Length = 645 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 QELLNPAFAKRKSVTLGQRQRQRLGTSCKF 92 QELL+PAFAKRKS TLGQRQRQRLGTSC+F Sbjct: 616 QELLHPAFAKRKSATLGQRQRQRLGTSCQF 645 >ref|XP_003518796.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Glycine max] Length = 643 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 QELLNPAFAKRKSVTLGQRQRQRLGTSCKF 92 QELL PAFAKRKS+TLGQRQRQRLGTSC+F Sbjct: 614 QELLYPAFAKRKSITLGQRQRQRLGTSCQF 643 >ref|XP_006573180.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Glycine max] Length = 639 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 QELLNPAFAKRKSVTLGQRQRQRLGTSCKF 92 QELL PAFAKRKS+TLGQRQRQRLGTSC+F Sbjct: 610 QELLYPAFAKRKSITLGQRQRQRLGTSCQF 639 >ref|XP_002514582.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis] gi|223546186|gb|EEF47688.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis] Length = 647 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 QELLNPAFAKRKSVTLGQRQRQRLGTSCKF 92 QELL PAF KRKSVTLGQRQRQRLGTSC+F Sbjct: 618 QELLYPAFNKRKSVTLGQRQRQRLGTSCQF 647 >ref|XP_006306992.1| hypothetical protein CARUB_v10008568mg [Capsella rubella] gi|482575703|gb|EOA39890.1| hypothetical protein CARUB_v10008568mg [Capsella rubella] Length = 632 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 QELLNPAFAKRKSVTLGQRQRQRLGTSCKF 92 QELL PAF KRKS+TLGQ+QRQRLGTSC+F Sbjct: 603 QELLYPAFEKRKSITLGQKQRQRLGTSCQF 632