BLASTX nr result
ID: Rehmannia25_contig00007116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00007116 (435 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004172308.1| PREDICTED: flavin-containing monooxygenase Y... 60 3e-07 ref|XP_004150279.1| PREDICTED: flavin-containing monooxygenase Y... 60 3e-07 gb|EMJ24130.1| hypothetical protein PRUPE_ppa005244mg [Prunus pe... 56 4e-06 >ref|XP_004172308.1| PREDICTED: flavin-containing monooxygenase YUCCA6-like [Cucumis sativus] Length = 434 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 313 RRRLTKYLEDYADGFDIRPVFNRRVVSAEFDRVLGFWRV 429 +++ KYLEDYA+ FDIRP FN V+ AE+DR LGFWRV Sbjct: 112 KQQFVKYLEDYAERFDIRPRFNETVIEAEYDRTLGFWRV 150 >ref|XP_004150279.1| PREDICTED: flavin-containing monooxygenase YUCCA6-like, partial [Cucumis sativus] Length = 353 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 313 RRRLTKYLEDYADGFDIRPVFNRRVVSAEFDRVLGFWRV 429 +++ KYLEDYA+ FDIRP FN V+ AE+DR LGFWRV Sbjct: 31 KQQFVKYLEDYAERFDIRPRFNETVIEAEYDRTLGFWRV 69 >gb|EMJ24130.1| hypothetical protein PRUPE_ppa005244mg [Prunus persica] Length = 471 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +1 Query: 313 RRRLTKYLEDYADGFDIRPVFNRRVVSAEFDRVLGFWRVWT 435 +++ +YLEDYA FDIRP FN V SAEFD LGFWRV T Sbjct: 142 KQQFIQYLEDYATKFDIRPRFNEAVASAEFDSKLGFWRVRT 182